Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-STAT1 Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: NIH/3T3 cell lysate)

Rabbit STAT1 Polyclonal Antibody | anti-STAT1 antibody

STAT1 antibody - N-terminal region

Gene Names
Stat1; AA408197; 2010005J02Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
STAT1; Polyclonal Antibody; STAT1 antibody - N-terminal region; anti-STAT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QLQSWFTIVAETLQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFL
Sequence Length
749
Applicable Applications for anti-STAT1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 86%; Mouse: 100%; Pig: 86%; Rabbit: 93%; Rat: 100%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse STAT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-STAT1 Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: NIH/3T3 cell lysate)

Western Blot (WB) (WB Suggested Anti-STAT1 Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: NIH/3T3 cell lysate)
Related Product Information for anti-STAT1 antibody
This is a rabbit polyclonal antibody against STAT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Stat1 is a member of the STAT family. It can form homodimers to modulate the transcriptional repression of PPARgamma2 in adipocytes

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
signal transducer and activator of transcription 1 isoform 2
NCBI Official Synonym Full Names
signal transducer and activator of transcription 1
NCBI Official Symbol
Stat1
NCBI Official Synonym Symbols
AA408197; 2010005J02Rik
NCBI Protein Information
signal transducer and activator of transcription 1
UniProt Protein Name
Signal transducer and activator of transcription 1
UniProt Gene Name
Stat1

Uniprot Description

Signal transducer and transcription activator that mediates cellular responses to interferons (IFNs), cytokine KITLG/SCF and other cytokines and other growth factors. Following type I IFN (IFN-alpha and IFN-beta) binding to cell surface receptors, signaling via protein kinases leads to activation of Jak kinases (TYK2 and JAK1) and to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of IFN-stimulated genes (ISG), which drive the cell in an antiviral state. In response to type II IFN (IFN-gamma), STAT1 is tyrosine- and serine-phosphorylated. It then forms a homodimer termed IFN-gamma-activated factor (GAF), migrates into the nucleus and binds to the IFN gamma activated sequence (GAS) to drive the expression of the target genes, inducing a cellular antiviral state. Becomes activated in response to KITLG/SCF and KIT signaling. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4.

Research Articles on STAT1

Similar Products

Product Notes

The STAT1 stat1 (Catalog #AAA3203397) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAT1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's STAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STAT1 stat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLQSWFTIVA ETLQQIRQQL KKLEELEQKF TYEPDPITKN KQVLSDRTFL. It is sometimes possible for the material contained within the vial of "STAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.