Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TP53I3 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellTP53I3 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit TP53I3 Polyclonal Antibody | anti-TP53I3 antibody

TP53I3 antibody - C-terminal region

Gene Names
TP53I3; PIG3
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TP53I3; Polyclonal Antibody; TP53I3 antibody - C-terminal region; anti-TP53I3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLY
Sequence Length
332
Applicable Applications for anti-TP53I3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TP53I3 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellTP53I3 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-TP53I3 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellTP53I3 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-TP53I3 antibody
This is a rabbit polyclonal antibody against TP53I3. It was validated on Western Blot

Target Description: The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer.
Product Categories/Family for anti-TP53I3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
quinone oxidoreductase PIG3 isoform 1
NCBI Official Synonym Full Names
tumor protein p53 inducible protein 3
NCBI Official Symbol
TP53I3
NCBI Official Synonym Symbols
PIG3
NCBI Protein Information
quinone oxidoreductase PIG3
UniProt Protein Name
Quinone oxidoreductase PIG3
Protein Family
UniProt Gene Name
TP53I3
UniProt Synonym Gene Names
PIG3
UniProt Entry Name
QORX_HUMAN

NCBI Description

The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Uniprot Description

TP53I3: May be involved in the generation of reactive oxygen species (ROS). Has low NADPH-dependent beta-naphthoquinone reductase activity, with a preference for 1,2-beta-naphthoquinone over 1,4-beta-naphthoquinone. Has low NADPH-dependent diamine reductase activity (in vitro). Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.-.-.-; Oxidoreductase

Chromosomal Location of Human Ortholog: 2p23.3

Molecular Function: protein homodimerization activity; zinc ion binding; NADPH:quinone reductase activity; quinone binding

Biological Process: NADP metabolic process

Research Articles on TP53I3

Similar Products

Product Notes

The TP53I3 tp53i3 (Catalog #AAA3216448) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TP53I3 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TP53I3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TP53I3 tp53i3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFNYKKEDFS EATLKFTKGA GVNLILDCIG GSYWEKNVNC LALDGRWVLY. It is sometimes possible for the material contained within the vial of "TP53I3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.