Rabbit UPF1 Polyclonal Antibody | anti-UPF1 antibody

UPF1 antibody - middle region

Cat. Num. AAA3203089

• Gene Names: UPF1; HUPF1; NORF1; RENT1; smg-2; pNORF1
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: UPF1; Polyclonal Antibody; UPF1 antibody - middle region; anti-UPF1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG
• Sequence Length: 1118

• Applicable Applications for anti-UPF1 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 83%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UPF1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-UPF1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-UPF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Related Product Information for anti-UPF1 antibody

This is a rabbit polyclonal antibody against UPF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UPF1 is a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. UPF1 is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene.This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-UPF1 antibody

Polyclonal; RNA Binding Proteins; Drugs and Drug Metabolism; Chromatin & Nuclear Signaling; DNA Repair

NCBI and Uniprot Product Information

• NCBI GI #: 18375673
• NCBI GeneID: 5976
• NCBI Accession #: NP_002902
• NCBI GenBank Nucleotide #: NM_002911
• UniProt Accession #: Q92900
• Molecular Weight: 123kDa
• NCBI Official Full Name: regulator of nonsense transcripts 1 isoform 2
• NCBI Official Synonym Full Names: UPF1 RNA helicase and ATPase
• NCBI Official Symbol: UPF1
• NCBI Official Synonym Symbols: HUPF1; NORF1; RENT1; smg-2; pNORF1
• NCBI Protein Information: regulator of nonsense transcripts 1
• UniProt Protein Name: Regulator of nonsense transcripts 1
• Protein Family: ATP-dependent helicase
• UniProt Gene Name: UPF1
• UniProt Synonym Gene Names: KIAA0221; RENT1; NORF1; hUpf1
• UniProt Entry Name: RENT1_HUMAN

NCBI Description

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

RENT1: RNA-dependent helicase and ATPase required for nonsense- mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD. Recruited by release factors to stalled ribosomes together with the SMG1C protein kinase complex to form the transient SURF (SMG1-UPF1-eRF1- eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) (located 50-55 or more nucleotides downstream from the termination codon) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Phosphorylated UPF1 is recognized by EST1B/SMG5, SMG6 and SMG7 which are thought to provide a link to the mRNA degradation machinery involving exonucleolytic and endonucleolytic pathways, and to serve as adapters to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation and allowing the recycling of NMD factors. UPF1 can also activate NMD without UPF2 or UPF3, and in the absence of the NMD-enhancing downstream EJC indicative for alternative NMD pathways. Plays a role in replication-dependent histone mRNA degradation at the end of phase S; the function is independent of UPF2. For the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. The ATPase activity of UPF1 is required for disassembly of mRNPs undergoing NMD. Essential for embryonic viability. Found in a post-splicing messenger ribonucleoprotein (mRNP) complex. Associates with the exon junction complex (EJC). Associates with the SGM1C complex; is phosphorylated by the complex kinase component SGM1. Interacts with UPF2, UPF3A and UPF3B. Interacts with EST1A and SLBP. Interacts (when hyperphosphorylated) with PNRC2. Interacts with EIF2C1, EIF2C2 and GSPT2. Ubiquitous. Belongs to the DNA2/NAM7 helicase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; C2H2-type zinc finger protein; EC 3.6.4.-; Hydrolase; EC 3.6.1.-

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus; chromatin

Molecular Function: protein binding; DNA binding; zinc ion binding; RNA binding; chromatin binding; helicase activity; ATP binding; ATP-dependent RNA helicase activity

Biological Process: mRNA export from nucleus; dosage compensation, by inactivation of X chromosome; mRNA catabolic process, nonsense-mediated decay; gene expression; DNA replication; DNA repair; regulation of translational termination