Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AKAP10Sample Type: 293TAntibody Dilution: 1.0ug/mlAKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit AKAP10 Polyclonal Antibody | anti-AKAP10 antibody

AKAP10 antibody - middle region

Gene Names
AKAP10; PRKA10; AKAP-10; D-AKAP2; D-AKAP-2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AKAP10; Polyclonal Antibody; AKAP10 antibody - middle region; anti-AKAP10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ
Sequence Length
662
Applicable Applications for anti-AKAP10 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AKAP10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AKAP10Sample Type: 293TAntibody Dilution: 1.0ug/mlAKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: AKAP10Sample Type: 293TAntibody Dilution: 1.0ug/mlAKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB)

(WB Suggested Anti-AKAP10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysate)

Western Blot (WB) (WB Suggested Anti-AKAP10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: RPMI 8226 cell lysate)
Related Product Information for anti-AKAP10 antibody
This is a rabbit polyclonal antibody against AKAP10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.
Product Categories/Family for anti-AKAP10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
A-kinase anchor protein 10, mitochondrial isoform 1
NCBI Official Synonym Full Names
A-kinase anchoring protein 10
NCBI Official Symbol
AKAP10
NCBI Official Synonym Symbols
PRKA10; AKAP-10; D-AKAP2; D-AKAP-2
NCBI Protein Information
A-kinase anchor protein 10, mitochondrial
UniProt Protein Name
A-kinase anchor protein 10, mitochondrial
Protein Family
UniProt Gene Name
AKAP10
UniProt Synonym Gene Names
AKAP-10; D-AKAP-2; PRKA10
UniProt Entry Name
AKA10_HUMAN

NCBI Description

This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins bind to the regulatory subunits of protein kinase A (PKA) and confine the holoenzyme to discrete locations within the cell. The encoded protein is localized to mitochondria and interacts with both the type I and type II regulatory subunits of PKA. Polymorphisms in this gene may be associated with increased risk of arrhythmias and sudden cardiac death. [provided by RefSeq, May 2012]

Uniprot Description

AKAP10: Differentially targeted protein that binds to type I and II regulatory subunits of protein kinase A and anchors them to the mitochondria or the plasma membrane. Although the physiological relevance between PKA and AKAPS with mitochondria is not fully understood, one idea is that BAD, a proapoptotic member, is phosphorylated and inactivated by mitochondria-anchored PKA. It cannot be excluded too that it may facilitate PKA as well as G protein signal transduction, by acting as an adapter for assembling multiprotein complexes. With its RGS domain, it could lead to the interaction to G-alpha proteins, providing a link between the signaling machinery and the downstream kinase. Genetic variations in AKAP10 are a cause of susceptibility to sudden cardiac death (SCD). Unexpected rapid natural death due to cardiovascular collapse within one hour of initial symptoms. It is usually caused by the worsening of existing heart diseases. The sudden onset of symptoms, such as chest pain and cardiac arrhythmias, particularly ventricular tachycardia, can lead to the loss of consciousness and cardiac arrest followed by biological death. Increased susceptibility to sudden cardiac death may be conferred by AKAP10 variants that are associated with markers of low vagus nerve sensitivity, e.g. fast basal heart rate and low heart rate variability.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17p11.1

Cellular Component: mitochondrion; cytoplasm; plasma membrane; cytosol

Biological Process: protein localization; signal transduction; blood coagulation

Disease: Cardiac Conduction Defect

Research Articles on AKAP10

Similar Products

Product Notes

The AKAP10 akap10 (Catalog #AAA3203080) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKAP10 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AKAP10 akap10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESLYQRTYAG KMTFGRVSDL GQFIRESEPE PDVRKSKGSM FSQAMKKWVQ. It is sometimes possible for the material contained within the vial of "AKAP10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.