Western Blot (WB)
(Host: RabbitTarget Name: NUFIP1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human NUFIP1 Polyclonal Antibody | anti-NUFIP1 antibody
NUFIP1 antibody - N-terminal region
Gene Names
NUFIP1; NUFIP; bA540M5.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUFIP1; Polyclonal Antibody; NUFIP1 antibody - N-terminal region; anti-NUFIP1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSL
Sequence Length
495
Applicable Applications for anti-NUFIP1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NUFIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NUFIP1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NUFIP1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NUFIP1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NUFIP1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-NUFIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-NUFIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-NUFIP1 antibody
This is a rabbit polyclonal antibody against NUFIP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The exact function of NUFIP1 remains unknown.
Target Description: The exact function of NUFIP1 remains unknown.
Product Categories/Family for anti-NUFIP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
nuclear fragile X mental retardation-interacting protein 1
NCBI Official Synonym Full Names
nuclear FMR1 interacting protein 1
NCBI Official Symbol
NUFIP1
NCBI Official Synonym Symbols
NUFIP; bA540M5.1
NCBI Protein Information
nuclear fragile X mental retardation-interacting protein 1
UniProt Protein Name
Nuclear fragile X mental retardation-interacting protein 1
Protein Family
UniProt Gene Name
NUFIP1
UniProt Entry Name
NUFP1_HUMAN
NCBI Description
This gene encodes a nuclear RNA binding protein that contains a C2H2 zinc finger motif and a nuclear localization signal. This protein is associated with the nuclear matrix in perichromatin fibrils and, in neurons, localizes to the cytoplasm in association with endoplasmic reticulum ribosomes. This protein interacts with the fragile X mental retardation protein (FMRP), the tumor suppressor protein BRCA1, upregulates RNA polymerase II transcription, and is involved in box C/D snoRNP biogenesis. A pseudogene of this gene resides on chromosome 6q12. [provided by RefSeq, Feb 2012]
Research Articles on NUFIP1
Similar Products
Product Notes
The NUFIP1 nufip1 (Catalog #AAA3202797) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUFIP1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUFIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUFIP1 nufip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQPWNFHAST SWYWRQSSDR FPRHQKSFNP AVKNSYYPRK YDAKFTDFSL. It is sometimes possible for the material contained within the vial of "NUFIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
