Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ECD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit ECD Polyclonal Antibody | anti-ECD antibody

ECD antibody - N-terminal region

Gene Names
ECD; GCR2; SGT1; HSGT1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ECD; Polyclonal Antibody; ECD antibody - N-terminal region; anti-ECD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAHMFGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEA
Sequence Length
644
Applicable Applications for anti-ECD antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ECD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ECD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ECD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-ECD antibody
This is a rabbit polyclonal antibody against ECD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The exact function of ECD remains unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
protein ecdysoneless homolog isoform 1
NCBI Official Synonym Full Names
ecdysoneless cell cycle regulator
NCBI Official Symbol
ECD
NCBI Official Synonym Symbols
GCR2; SGT1; HSGT1
NCBI Protein Information
protein ecdysoneless homolog
UniProt Protein Name
Protein SGT1
Protein Family
UniProt Gene Name
ECD
UniProt Synonym Gene Names
SGT1; hSGT1
UniProt Entry Name
SGT1_HUMAN

Uniprot Description

SGT1: Novel regulator of p53 stability and function. May also be a transcriptional activator required for the expression of glycolytic genes. Belongs to the SGT1 family.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 10q22.3

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; transcription coactivator activity

Biological Process: transcription from RNA polymerase II promoter; cell proliferation; regulation of transcription, DNA-dependent; regulation of glycolysis

Research Articles on ECD

Similar Products

Product Notes

The ECD ecd (Catalog #AAA3201271) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ECD antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ECD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ECD ecd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PAHMFGVTKF GDNIEDEWFI VYVIKQITKE FPELVARIED NDGEFLLIEA. It is sometimes possible for the material contained within the vial of "ECD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.