Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: CUL5Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit CUL5 Polyclonal Antibody | anti-CUL5 antibody

CUL5 antibody - C-terminal region

Gene Names
CUL5; CUL-5; VACM1; VACM-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
CUL5; Polyclonal Antibody; CUL5 antibody - C-terminal region; anti-CUL5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH
Sequence Length
780
Applicable Applications for anti-CUL5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CUL5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: CUL5Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: CUL5Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-CUL5 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-CUL5 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-CUL5 antibody
This is a rabbit polyclonal antibody against CUL5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.
Product Categories/Family for anti-CUL5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
cullin-5
NCBI Official Synonym Full Names
cullin 5
NCBI Official Symbol
CUL5
NCBI Official Synonym Symbols
CUL-5; VACM1; VACM-1
NCBI Protein Information
cullin-5
UniProt Protein Name
Cullin-5
Protein Family
UniProt Gene Name
CUL5
UniProt Synonym Gene Names
VACM1; CUL-5; VACM-1
UniProt Entry Name
CUL5_HUMAN

Uniprot Description

CUL5: a component of E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to be involved proteasomal degradation of p53/TP53 stimulated by adenovirus E1B-55 kDa protein. Member of the cullin family.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 11q22.3

Cellular Component: Cul5-RING ubiquitin ligase complex; plasma membrane; cytosol; nucleus

Molecular Function: protein binding; protein heterodimerization activity; ubiquitin protein ligase binding; calcium channel activity; receptor activity

Biological Process: ubiquitin-dependent protein catabolic process; negative regulation of cell proliferation; cell proliferation; cytosolic calcium ion homeostasis; viral reproduction; protein ubiquitination; cell cycle arrest; response to osmotic stress; G1/S transition of mitotic cell cycle

Research Articles on CUL5

Similar Products

Product Notes

The CUL5 cul5 (Catalog #AAA3202439) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CUL5 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CUL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CUL5 cul5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VNIKILNAGA WSRSSEKVFV SLPTELEDLI PEVEEFYKKN HSGRKLHWHH. It is sometimes possible for the material contained within the vial of "CUL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.