Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EPLIN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

Rabbit LIMA1 Polyclonal Antibody | anti-LIMA1 antibody

LIMA1 Antibody - middle region

Gene Names
LIMA1; EPLIN; LDLCQ8; SREBP3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LIMA1; Polyclonal Antibody; LIMA1 Antibody - middle region; anti-LIMA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGIKM
Sequence Length
759
Applicable Applications for anti-LIMA1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LIMA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EPLIN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-EPLIN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)
Related Product Information for anti-LIMA1 antibody
This is a rabbit polyclonal antibody against LIMA1. It was validated on Western Blot

Target Description: This gene encodes a cytoskeleton-associated protein that inhibits actin filament depolymerization and cross-links filaments in bundles. It is downregulated in some cancer cell lines. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and expression of some of the variants maybe independently regulated.
Product Categories/Family for anti-LIMA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
LIM domain and actin-binding protein 1 isoform 2
NCBI Official Synonym Full Names
LIM domain and actin binding 1
NCBI Official Symbol
LIMA1
NCBI Official Synonym Symbols
EPLIN; LDLCQ8; SREBP3
NCBI Protein Information
LIM domain and actin-binding protein 1
UniProt Protein Name
LIM domain and actin-binding protein 1
UniProt Gene Name
LIMA1
UniProt Synonym Gene Names
EPLIN; SREBP3
UniProt Entry Name
LIMA1_HUMAN

NCBI Description

This gene encodes a cytoskeleton-associated protein that inhibits actin filament depolymerization and cross-links filaments in bundles. It is downregulated in some cancer cell lines. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and expression of some of the variants maybe independently regulated. [provided by RefSeq, Aug 2011]

Uniprot Description

eplin: Binds to actin monomers and filaments. Increases the number and size of actin stress fibers and inhibits membrane ruffling. Inhibits actin filament depolymerization. Bundles actin filaments, delays filament nucleation and reduces formation of branched filaments. 4 isoforms of the human protein are produced by alternative promoter.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal; Actin-binding

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: focal adhesion; cytoplasm; plasma membrane; stress fiber; cleavage furrow; actin cytoskeleton

Molecular Function: actin monomer binding; actin filament binding; protein binding; zinc ion binding

Biological Process: actin filament bundle formation; ruffle organization and biogenesis; negative regulation of actin filament depolymerization

Research Articles on LIMA1

Similar Products

Product Notes

The LIMA1 lima1 (Catalog #AAA3202130) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIMA1 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LIMA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LIMA1 lima1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVLAASMEAK ASSQQEKEDK PAETKKLRIA WPPPTELGSS GSALEEGIKM. It is sometimes possible for the material contained within the vial of "LIMA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.