Western Blot (WB)
(WB Suggested Anti-KIF22 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateKIF22 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Rabbit KIF22 Polyclonal Antibody | anti-KIF22 antibody
KIF22 antibody - C-terminal region
Gene Names
KIF22; KID; OBP; KNSL4; OBP-1; OBP-2; SEMDJL2; A-328A3.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast
Applications
Western Blot
Purity
Protein A purified
Synonyms
KIF22; Polyclonal Antibody; KIF22 antibody - C-terminal region; anti-KIF22 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ
Sequence Length
665
Applicable Applications for anti-KIF22 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 90%; Pig: 93%; Rat: 93%; Yeast: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KIF22
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-KIF22 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateKIF22 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Western Blot (WB)
(WB Suggested Anti-KIF22 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateKIF22 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-KIF22 antibody
This is a rabbit polyclonal antibody against KIF22. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.The protein encoded by this gene is a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.
Target Description: KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.The protein encoded by this gene is a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.
Product Categories/Family for anti-KIF22 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
kinesin-like protein KIF22 isoform 1
NCBI Official Synonym Full Names
kinesin family member 22
NCBI Official Symbol
KIF22
NCBI Official Synonym Symbols
KID; OBP; KNSL4; OBP-1; OBP-2; SEMDJL2; A-328A3.2
NCBI Protein Information
kinesin-like protein KIF22
UniProt Protein Name
Kinesin-like protein KIF22
Protein Family
UniProt Gene Name
KIF22
UniProt Synonym Gene Names
KID; KNSL4
UniProt Entry Name
KIF22_HUMAN
NCBI Description
The protein encoded by this gene is a member of the kinesin-like protein family. The family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
Research Articles on KIF22
Similar Products
Product Notes
The KIF22 kif22 (Catalog #AAA3201792) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF22 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's KIF22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KIF22 kif22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LASQGSQGAP LLSTPKRERM VLMKTVEEKD LEIERLKTKQ KELEAKMLAQ. It is sometimes possible for the material contained within the vial of "KIF22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
