Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UBTF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Hela cell lysateUBTF is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit UBTF Polyclonal Antibody | anti-UBTF antibody

UBTF antibody - middle region

Gene Names
UBTF; UBF; UBF1; UBF2; UBF-1; CONDBA; NOR-90
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBTF; Polyclonal Antibody; UBTF antibody - middle region; anti-UBTF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPV
Sequence Length
764
Applicable Applications for anti-UBTF antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 79%; Horse: 77%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UBTF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UBTF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Hela cell lysateUBTF is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-UBTF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Hela cell lysateUBTF is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-UBTF antibody
This is a rabbit polyclonal antibody against UBTF. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UBTF is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1. Two UBTF polypeptides, of 94 and 97 kD, exist in the human. UBTF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxesUpstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD, exist in the human (Bell et al., 1988 [PubMed 3413483]). UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
nucleolar transcription factor 1 isoform a
NCBI Official Synonym Full Names
upstream binding transcription factor
NCBI Official Symbol
UBTF
NCBI Official Synonym Symbols
UBF; UBF1; UBF2; UBF-1; CONDBA; NOR-90
NCBI Protein Information
nucleolar transcription factor 1
UniProt Protein Name
Nucleolar transcription factor 1
UniProt Gene Name
UBTF
UniProt Synonym Gene Names
UBF; UBF1; UBF-1
UniProt Entry Name
UBF1_HUMAN

NCBI Description

This gene encodes a member of the HMG-box DNA-binding protein family. The encoded protein plays a critical role in ribosomal RNA transcription as a key component of the pre-initiation complex, mediating the recruitment of RNA polymerase I to rDNA promoter regions. The encoded protein may also play important roles in chromatin remodeling and pre-rRNA processing, and its activity is regulated by both phosphorylation and acetylation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Pseudogenes of this gene are located on the short arm of chromosomes 3, 11 and X and the long arm of chromosome 11. [provided by RefSeq, Aug 2011]

Uniprot Description

UBF: a transcription factor that recognizes the ribosomal RNA gene promoter and activates transcription mediated by RNA polymerase I through cooperative interactions with the species-specific factor SL1. Activate RNA polymerase II-regulated, beta-catenin-responsive promoters. Interacts with TAF1, a factor involved in the transcription of cell cycle and growth regulatory genes. It binds specifically to the upstream control element. Two splice variant isoforms have been described.

Protein type: Nucleolus; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 17q21.31

Cellular Component: nucleoplasm; nucleolus

Molecular Function: protein binding; DNA binding; chromatin binding

Biological Process: chromatin remodeling; regulation of transcription from RNA polymerase I promoter; regulation of transcription, DNA-dependent; negative regulation of gene expression, epigenetic; transcription from RNA polymerase I promoter; RNA elongation from RNA polymerase I promoter; gene expression; transcription initiation from RNA polymerase I promoter; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic; positive regulation of transcription from RNA polymerase I promoter

Research Articles on UBTF

Similar Products

Product Notes

The UBTF ubtf (Catalog #AAA3201547) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBTF antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBTF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBTF ubtf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LESLPEEEQQ RVLGEEKMLN INKKQATSPA SKKPAQEGGK GGSEKPKRPV. It is sometimes possible for the material contained within the vial of "UBTF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.