Mouse UBTF Monoclonal Antibody | anti-UBTF antibody

UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (AP)

Cat. Num. AAA6163287

• Gene Names: UBTF; UBF; UBF1; UBF2; UBF-1; CONDBA; NOR-90
• Applications: Western Blot
• Purity: Purified
• Synonyms: UBTF; Monoclonal Antibody; UBTF (Upstream Binding Transcription Factor; RNA Polymerase I; NOR-90; UBF) (AP); Upstream Binding Transcription Factor; UBF; anti-UBTF antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C6
• Specificity: Recognizes UBTF.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-UBTF antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: UBTF (NP_055048, 551aa-650aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(UBTF monoclonal antibody (M05), clone 2C6 Western Blot analysis of UBTF expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged UBTF is approximately 30ng/ml as a capture antibody.)

Western Blot (WB)

(UBTF monoclonal antibody (M05), clone 2C6. Western Blot analysis of UBTF expression in PC-12.)

Related Product Information for anti-UBTF antibody

Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD, exist in the human (Bell et al., 1988 [PubMed 3413483]). UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]). [supplied by OMIM]

Product Categories/Family for anti-UBTF antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 7657671
• NCBI GeneID: 7343
• NCBI Accession #: NP_055048
• NCBI GenBank Nucleotide #: NM_014233
• UniProt Accession #: P17480
• Molecular Weight: 89kDa
• NCBI Official Full Name: nucleolar transcription factor 1 isoform a
• NCBI Official Synonym Full Names: upstream binding transcription factor
• NCBI Official Symbol: UBTF
• NCBI Official Synonym Symbols: UBF; UBF1; UBF2; UBF-1; CONDBA; NOR-90
• NCBI Protein Information: nucleolar transcription factor 1
• UniProt Protein Name: Nucleolar transcription factor 1
• Protein Family: Nucleolar transcription factor
• UniProt Gene Name: UBTF
• UniProt Synonym Gene Names: UBF; UBF1; UBF-1
• UniProt Entry Name: UBF1_HUMAN

NCBI Description

This gene encodes a member of the HMG-box DNA-binding protein family. The encoded protein plays a critical role in ribosomal RNA transcription as a key component of the pre-initiation complex, mediating the recruitment of RNA polymerase I to rDNA promoter regions. The encoded protein may also play important roles in chromatin remodeling and pre-rRNA processing, and its activity is regulated by both phosphorylation and acetylation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Pseudogenes of this gene are located on the short arm of chromosomes 3, 11 and X and the long arm of chromosome 11. [provided by RefSeq, Aug 2011]

Uniprot Description

UBF: a transcription factor that recognizes the ribosomal RNA gene promoter and activates transcription mediated by RNA polymerase I through cooperative interactions with the species-specific factor SL1. Activate RNA polymerase II-regulated, beta-catenin-responsive promoters. Interacts with TAF1, a factor involved in the transcription of cell cycle and growth regulatory genes. It binds specifically to the upstream control element. Two splice variant isoforms have been described.

Protein type: Nucleolus; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 17q21.31

Cellular Component: nucleoplasm; nucleolus

Molecular Function: protein binding; DNA binding; chromatin binding

Biological Process: chromatin remodeling; regulation of transcription from RNA polymerase I promoter; regulation of transcription, DNA-dependent; negative regulation of gene expression, epigenetic; transcription from RNA polymerase I promoter; RNA elongation from RNA polymerase I promoter; gene expression; transcription initiation from RNA polymerase I promoter; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic; positive regulation of transcription from RNA polymerase I promoter