Western Blot (WB)
(Host: RabbitTarget Name: TUT1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Rabbit TUT1 Polyclonal Antibody | anti-TUT1 antibody
TUT1 antibody - N-terminal region
Gene Names
TUT1; PAPD2; RBM21; TENT1; URLC6; TUTase; STARPAP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TUT1; Polyclonal Antibody; TUT1 antibody - N-terminal region; anti-TUT1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDS
Sequence Length
874
Applicable Applications for anti-TUT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TUT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TUT1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TUT1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-TUT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-TUT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Related Product Information for anti-TUT1 antibody
This is a rabbit polyclonal antibody against TUT1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TUT1 is a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. TUT1 specifically adds and removes nucleotides from the 3' end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation.TUT1 specifically catalyzes uridylylation of U6 snRNA (RNU6; MIM 180692) and is essential for cell proliferation (Trippe et al., 2006 [PubMed 16790842]).[supplied by OMIM].
Target Description: TUT1 is a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. TUT1 specifically adds and removes nucleotides from the 3' end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation.TUT1 specifically catalyzes uridylylation of U6 snRNA (RNU6; MIM 180692) and is essential for cell proliferation (Trippe et al., 2006 [PubMed 16790842]).[supplied by OMIM].
Product Categories/Family for anti-TUT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
94kDa
NCBI Official Full Name
speckle targeted PIP5K1A-regulated poly(A) polymerase isoform 1
NCBI Official Synonym Full Names
terminal uridylyl transferase 1, U6 snRNA-specific
NCBI Official Symbol
TUT1
NCBI Official Synonym Symbols
PAPD2; RBM21; TENT1; URLC6; TUTase; STARPAP
NCBI Protein Information
speckle targeted PIP5K1A-regulated poly(A) polymerase
Protein Family
NCBI Description
This gene encodes a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. The encoded enzyme specifically adds and removes nucleotides from the 3' end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation.[provided by RefSeq, Apr 2009]
Research Articles on TUT1
Similar Products
Product Notes
The TUT1 (Catalog #AAA3201428) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUT1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TUT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TUT1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CDLDLFLDLG DLEEPQPVPK APESPSLDSA LASPLDPQAL ACTPASPPDS. It is sometimes possible for the material contained within the vial of "TUT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
