Immunohistochemistry (IHC)
(Human kidney )
Rabbit PBX3 Polyclonal Antibody | anti-PBX3 antibody
PBX3 antibody - N-terminal region
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
PBX3; Polyclonal Antibody; PBX3 antibody - N-terminal region; anti-PBX3 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIM
Sequence Length
434
Applicable Applications for anti-PBX3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PBX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human kidney )
Immunohistochemistry (IHC)
(Human kidney )
Western Blot (WB)
(WB Suggested Anti-PBX3 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-PBX3 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-PBX3 antibody
This is a rabbit polyclonal antibody against PBX3. It was validated on Western Blot and immunohistochemistry
Target Description: PBX3 is a transcriptional activator that binds the sequence 5'-ATCAATCAA-3'.
Target Description: PBX3 is a transcriptional activator that binds the sequence 5'-ATCAATCAA-3'.
Product Categories/Family for anti-PBX3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
pre-B-cell leukemia transcription factor 3 isoform 1
NCBI Official Synonym Full Names
PBX homeobox 3
NCBI Official Symbol
PBX3
NCBI Protein Information
pre-B-cell leukemia transcription factor 3
UniProt Protein Name
Pre-B-cell leukemia transcription factor 3
Protein Family
UniProt Gene Name
PBX3
UniProt Entry Name
PBX3_HUMAN
Uniprot Description
PBX3: Transcriptional activator that binds the sequence 5'- ATCAATCAA-3'. Belongs to the TALE/PBX homeobox family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: DNA-binding
Chromosomal Location of Human Ortholog: 9q33.3
Cellular Component: transcription factor complex; nucleus
Molecular Function: sequence-specific DNA binding; transcription factor activity
Biological Process: dorsal spinal cord development; posterior compartment specification; anterior compartment specification; transcription, DNA-dependent; regulation of transcription, DNA-dependent; adult locomotory behavior; neuron development; neurological control of breathing; respiratory gaseous exchange
Research Articles on PBX3
Similar Products
Product Notes
The PBX3 pbx3 (Catalog #AAA3200740) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PBX3 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PBX3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PBX3 pbx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRMLQTLAGV NLAGHSVQGG MALPPPPHGH EGADGDGRKQ DIGDILHQIM. It is sometimes possible for the material contained within the vial of "PBX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
