Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RASA1 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse RASA1 Monoclonal Antibody | anti-RASA1 antibody

RASA1 (RAS p21 Protein Activator (GTPase Activating Protein) 1, CM-AVM, CMAVM, DKFZp434N071, GAP, PKWS, RASA, RASGAP, p120GAP, p120RASGAP) (PE)

Gene Names
RASA1; GAP; PKWS; RASA; p120; CMAVM; CM-AVM; CMAVM1; RASGAP; p120GAP; p120RASGAP
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
RASA1; Monoclonal Antibody; RASA1 (RAS p21 Protein Activator (GTPase Activating Protein) 1; CM-AVM; CMAVM; DKFZp434N071; GAP; PKWS; RASA; RASGAP; p120GAP; p120RASGAP) (PE); RAS p21 Protein Activator (GTPase Activating Protein) 1; p120RASGAP; anti-RASA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D4
Specificity
Recognizes RASA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1047
Applicable Applications for anti-RASA1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RASA1 (NP_002881, 948aa-1047aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RASA1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RASA1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RASA1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RASA1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-RASA1 antibody
The protein encoded by this gene is located in the cytoplasm and is part of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Alternative splicing results in two isoforms where the shorter isoform, lacking the N-terminal hydrophobic region but retaining the same activity, appears to be abundantly expressed in placental but not adult tissues. [provided by RefSeq]
Product Categories/Family for anti-RASA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ras GTPase-activating protein 1 isoform 1
NCBI Official Synonym Full Names
RAS p21 protein activator 1
NCBI Official Symbol
RASA1
NCBI Official Synonym Symbols
GAP; PKWS; RASA; p120; CMAVM; CM-AVM; CMAVM1; RASGAP; p120GAP; p120RASGAP
NCBI Protein Information
ras GTPase-activating protein 1
UniProt Protein Name
Ras GTPase-activating protein 1
UniProt Gene Name
RASA1
UniProt Synonym Gene Names
GAP; RASA; GAP; GTPase-activating protein; RasGAP
UniProt Entry Name
RASA1_HUMAN

NCBI Description

The protein encoded by this gene is located in the cytoplasm and is part of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Mutations also have been associated with hereditary capillary malformations (CM) with or without arteriovenous malformations (AVM) and Parkes Weber syndrome. Alternative splicing results in two isoforms where the shorter isoform, lacking the N-terminal hydrophobic region but retaining the same activity, appears to be abundantly expressed in placental but not adult tissues. [provided by RefSeq, May 2012]

Uniprot Description

RASA1: a GTPase activator for normal RAS p21 but not its oncogenic counterpart, converting it to the putatively inactive GDP-bound state. Acting as a suppressor of RAS function, it enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Two alternatively spliced isoforms have been described.

Protein type: Motility/polarity/chemotaxis; GAPs, Ras; Oncoprotein; GAPs

Chromosomal Location of Human Ortholog: 5q13.3

Cellular Component: ruffle; cytoplasm; cytosol

Molecular Function: GTPase binding; protein binding; glycoprotein binding; potassium channel inhibitor activity; receptor binding

Biological Process: axon guidance; negative regulation of cell adhesion; negative regulation of cell-matrix adhesion; signal transduction; regulation of cell shape; regulation of actin filament polymerization; embryonic development; cytokinesis after mitosis; regulation of RNA metabolic process; ephrin receptor signaling pathway; blood vessel morphogenesis; negative regulation of Ras protein signal transduction; negative regulation of neuron apoptosis; vascular endothelial growth factor receptor signaling pathway; vasculogenesis

Disease: Parkes Weber Syndrome; Capillary Malformation-arteriovenous Malformation; Basal Cell Carcinoma, Susceptibility To, 1

Research Articles on RASA1

Similar Products

Product Notes

The RASA1 rasa1 (Catalog #AAA6187087) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RASA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RASA1 rasa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RASA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.