Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RACGAP1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Rabbit RACGAP1 Polyclonal Antibody | anti-RACGAP1 antibody

RACGAP1 antibody - N-terminal region

Gene Names
RACGAP1; CYK4; ID-GAP; HsCYK-4; MgcRacGAP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
RACGAP1; Polyclonal Antibody; RACGAP1 antibody - N-terminal region; anti-RACGAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALD
Sequence Length
632
Applicable Applications for anti-RACGAP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RACGAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RACGAP1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-RACGAP1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Related Product Information for anti-RACGAP1 antibody
This is a rabbit polyclonal antibody against RACGAP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Rho GTPases control a variety of cellular processes. There are 3 subtypes of Rho GTPases in the Ras superfamily of small G proteins: RHO, RAC, and CDC42. GTPase-activating proteins (GAPs) bind activated forms of Rho GTPases and stimulate GTP hydrolysis. Through this catalytic function, Rho GAPs negatively regulate Rho-mediated signals. GAPs may also serve as effector molecules and play a role in signaling downstream of Rho and other Ras-like GTPases.
Product Categories/Family for anti-RACGAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
rac GTPase-activating protein 1 isoform a
NCBI Official Synonym Full Names
Rac GTPase activating protein 1
NCBI Official Symbol
RACGAP1
NCBI Official Synonym Symbols
CYK4; ID-GAP; HsCYK-4; MgcRacGAP
NCBI Protein Information
rac GTPase-activating protein 1
UniProt Protein Name
Rac GTPase-activating protein 1
UniProt Gene Name
RACGAP1
UniProt Synonym Gene Names
KIAA1478; MGCRACGAP; MgcRacGAP; CYK4; HsCYK-4
UniProt Entry Name
RGAP1_HUMAN

NCBI Description

This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12. [provided by RefSeq, Feb 2016]

Uniprot Description

MgcRacGAP: a rac GTPase activating protein. Plays an important role in cytokinesis by regulating cortical movement through RhoA. Phosphorylation by Aurora B apparently induces GAP activity toward RhoA.

Protein type: GAPs; GAPs, Rac/Rho

Chromosomal Location of Human Ortholog: 12q13.12

Cellular Component: nucleoplasm; microtubule; extrinsic to internal side of plasma membrane; acrosome; spindle midzone; midbody; cytosol; nucleus; cleavage furrow

Molecular Function: gamma-tubulin binding; protein binding; phosphatidylinositol-3,4,5-triphosphate binding; metal ion binding; microtubule binding; beta-tubulin binding; protein kinase binding; alpha-tubulin binding; GTPase activator activity

Biological Process: positive regulation of cytokinesis; regulation of attachment of spindle microtubules to kinetochore; spindle midzone assembly involved in mitosis; sulfate transport; antigen processing and presentation of exogenous peptide antigen via MHC class II; microtubule-based movement; regulation of small GTPase mediated signal transduction; embryonic development; cytokinesis after mitosis; small GTPase mediated signal transduction; neuroblast proliferation; spermatogenesis; blood coagulation; cytokinesis, contractile ring formation; positive regulation of GTPase activity

Research Articles on RACGAP1

Similar Products

Product Notes

The RACGAP1 racgap1 (Catalog #AAA3200634) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RACGAP1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RACGAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RACGAP1 racgap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EILSEGNEVQ FIQLAKDFED FRKKWQRTDH ELGKYKDLLM KAETERSALD. It is sometimes possible for the material contained within the vial of "RACGAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.