Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of AMACR expression in rat kidney extract (lane 1), rat liver extract (lane 2) and HEPG2 whole cell lysates (lane 3). AMACR at 42KD was detected using rabbit anti- AMACR Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit AMACR Polyclonal Antibody | anti-AMACR antibody

Anti-AMACR Antibody

Gene Names
AMACR; RM; RACE; CBAS4; AMACRD
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
AMACR; Polyclonal Antibody; Anti-AMACR Antibody; 2 arylpropionyl CoA epimerase; 2 methylacyl CoA racemase; 2-methylacyl-CoA racemase; Alpha methylacyl CoA racemase; Alpha-methylacyl-CoA racemase; Amacr; CBAS4; Da1-8; Macr1; RACE; RM; Q9UHK6; alpha-methylacyl-CoA racemase; anti-AMACR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
394
Applicable Applications for anti-AMACR antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat
Tested Species:In-house tested species with positive results.
Other applications have not been tested.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human AMACR (208-246aa RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK), different from the related mouse and rat sequences by four amino acids.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of AMACR expression in rat kidney extract (lane 1), rat liver extract (lane 2) and HEPG2 whole cell lysates (lane 3). AMACR at 42KD was detected using rabbit anti- AMACR Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of AMACR expression in rat kidney extract (lane 1), rat liver extract (lane 2) and HEPG2 whole cell lysates (lane 3). AMACR at 42KD was detected using rabbit anti- AMACR Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-AMACR antibody
Rabbit IgG polyclonal antibody for Alpha-methylacyl-CoA racemase (AMACR) detection.
Background: Alpha-methylacyl-CoA racemase (AMACR) is a mitochondrial and peroxisomal enzyme. It encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
References
1. Amery, L., Fransen, M., De Nys, K., Mannaerts, G. P., Van Veldhoven, P. P. Mitochondrial and peroxisomal targeting of 2-methylacyl-CoA racemase in humans. J. Lipid Res. 41: 1752-1759, 2000.
2. Clarke, C. E., Alger, S., Preece, M. A., Burdon, M. A., Chavda, S., Denis, S., Ferdinandusse, S., Wanders, R. J. A. Tremor and deep white matter changes in alpha-methylacyl-CoA racemase deficiency. Neurology 63: 188-189, 2004.
3. Dick, D., Horvath, R., Chinnery, P. F. AMACR mutations cause late-onset autosomal recessive cerebellar ataxia. Neurology 76: 1768-1770, 2011.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,860 Da
NCBI Official Full Name
alpha-methylacyl-CoA racemase isoform 3
NCBI Official Synonym Full Names
alpha-methylacyl-CoA racemase
NCBI Official Symbol
AMACR
NCBI Official Synonym Symbols
RM; RACE; CBAS4; AMACRD
NCBI Protein Information
alpha-methylacyl-CoA racemase
UniProt Protein Name
Alpha-methylacyl-CoA racemase
UniProt Gene Name
AMACR
UniProt Entry Name
AMACR_HUMAN

NCBI Description

This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. [provided by RefSeq, Mar 2011]

Uniprot Description

AMACR: Racemization of 2-methyl-branched fatty acid CoA esters. Responsible for the conversion of pristanoyl-CoA and C27-bile acyl-CoAs to their (S)-stereoisomers. Belongs to the CaiB/BaiF CoA-transferase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Isomerase; Mitochondrial; Lipid Metabolism - primary bile acid biosynthesis; EC 5.1.99.4

Chromosomal Location of Human Ortholog: 5p13

Cellular Component: cytoplasm; mitochondrion; peroxisomal matrix; peroxisome

Molecular Function: alpha-methylacyl-CoA racemase activity; receptor binding

Biological Process: bile acid biosynthetic process; bile acid metabolic process; fatty acid beta-oxidation using acyl-CoA oxidase

Disease: Alpha-methylacyl-coa Racemase Deficiency; Bile Acid Synthesis Defect, Congenital, 4

Research Articles on AMACR

Similar Products

Product Notes

The AMACR amacr (Catalog #AAA178483) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-AMACR Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's AMACR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat Tested Species:In-house tested species with positive results. Other applications have not been tested. Researchers should empirically determine the suitability of the AMACR amacr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMACR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.