Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Caspase-2 Picoband antibody, MBS177891, Western blottingAll lanes: Anti Caspase-2 (MBS177891) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: 293T Whole Cell Lysate at 40ugPredicted bind size: 18KDObserved bind size: 18KD )

Caspase-2 Polyclonal Antibody | anti-CASP2 antibody

Anti-Caspase-2 Antibody

Gene Names
CASP2; ICH1; NEDD2; CASP-2; NEDD-2; PPP1R57
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Caspase-2; Polyclonal Antibody; Anti-Caspase-2 Antibody; CASP 2; CASP-2; Casp2; CASP2_HUMAN; Caspase 2; Caspase 2 apoptosis related cysteine peptidase; Caspase-2 subunit p12; Caspase2; ICH 1; ICH 1 protease; ICH 1L; ICH1; ICH1 protease; ICH1L; NEDD-2; NEDD2; Neural precursor cell expressed developmentally down-regulated protein 2; PPP1R57; Protease ICH-1; Protein phosphatase 1 regulatory subunit 57; caspase 2; apoptosis-related cysteine peptidase; anti-CASP2 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
312
Applicable Applications for anti-CASP2 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Caspase-2(378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Caspase-2 Picoband antibody, MBS177891, Western blottingAll lanes: Anti Caspase-2 (MBS177891) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: 293T Whole Cell Lysate at 40ugPredicted bind size: 18KDObserved bind size: 18KD )

Western Blot (WB) (Anti- Caspase-2 Picoband antibody, MBS177891, Western blottingAll lanes: Anti Caspase-2 (MBS177891) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: 293T Whole Cell Lysate at 40ugPredicted bind size: 18KDObserved bind size: 18KD )
Related Product Information for anti-CASP2 antibody
Description: Rabbit IgG polyclonal antibody for Caspase-2(CASP2) detection. Tested with WB in Human;Mouse;Rat.

Background: CASP2 is equal to Caspase-2. And Caspase-2, which is involved in stress-induced apoptosis, is recruited into a large protein complex, the molecular composition of which remains elusive. It is showed that activation of caspase-2 occurs in a complex that contains the death domain-containing protein PIDD, whose expression is induced by p53, and the adaptor protein RAIDD. Increased PIDD expression resulted in spontaneous activation of caspase-2 and sensitization to apoptosis by genotoxic stimuli. Caspase-2 acts both as a positive and negative cell death effector, depending upon cell lineage and stage of development.
References
1. Bergeron, L.; Perez, G. I.; Macdonald, G.; Shi, L.; Sun, Y.; Jurisicova, A.; Varmuza, S.; Latham, K. E.; Flaws, J. A.; Salter, J. C. M.; Hara, H.; Moskowitz, M. A.; Li, E.; Greenberg, A.; Tilly, J. L.; Yuan, J. : Defects in regulation of apoptosis in caspase-2-deficient mice. Genes Dev. 12: 1304-1314, 1998. 2. Tinel, A.; Tschopp, J. : The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress. Science 304: 843-846, 2004.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
835
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10,309 Da
NCBI Official Full Name
caspase-2 isoform 2
NCBI Official Synonym Full Names
caspase 2
NCBI Official Symbol
CASP2
NCBI Official Synonym Symbols
ICH1; NEDD2; CASP-2; NEDD-2; PPP1R57
NCBI Protein Information
caspase-2
UniProt Protein Name
Caspase-2
Protein Family
UniProt Gene Name
CASP2
UniProt Synonym Gene Names
ICH1; NEDD2; CASP-2; NEDD-2
UniProt Entry Name
CASP2_HUMAN

NCBI Description

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimer's disease, Huntington's disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

CASP2: Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a p18 subunit and a p12 subunit. Interacts with LRDD. Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle. Belongs to the peptidase C14A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.22.55; Apoptosis

Chromosomal Location of Human Ortholog: 7q34-q35

Cellular Component: cytoplasm; cytosol; membrane; mitochondrion; nucleus

Molecular Function: cysteine-type endopeptidase activity; enzyme binding; protein binding; protein domain specific binding

Biological Process: aging; apoptosis; brain development; caspase activation; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; DNA damage response, signal transduction resulting in induction of apoptosis; germ cell programmed cell death; luteolysis; positive regulation of apoptosis; positive regulation of neuron apoptosis; protein processing; regulation of apoptosis

Research Articles on CASP2

Similar Products

Product Notes

The CASP2 casp2 (Catalog #AAA177891) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Caspase-2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Caspase-2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the CASP2 casp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Caspase-2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.