Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Caspase-2 Recombinant Protein | CASP2 recombinant protein

Recombinant Human Caspase-2

Gene Names
CASP2; ICH1; NEDD2; CASP-2; NEDD-2; PPP1R57
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Caspase-2; Recombinant Human Caspase-2; Neural precursor cell expressed developmentally down-regulated protein 2; NEDD-2; Protease ICH-1; CASP2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-452aa; Full Length
Sequence
AAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
Sequence Length
312
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CASP2 recombinant protein
Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival.
Product Categories/Family for CASP2 recombinant protein
References
Ich-1, an Ice/ced-3-related gene, encodes both positive and negative regulators of programmed cell death.Wang L., Miura M., Bergeron L., Zhu H., Yuan J.Cell 78:739-750(1994)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
835
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66.6 kDa
NCBI Official Full Name
caspase-2 isoform 2
NCBI Official Synonym Full Names
caspase 2
NCBI Official Symbol
CASP2
NCBI Official Synonym Symbols
ICH1; NEDD2; CASP-2; NEDD-2; PPP1R57
NCBI Protein Information
caspase-2
UniProt Protein Name
Caspase-2
Protein Family
UniProt Gene Name
CASP2
UniProt Synonym Gene Names
ICH1; NEDD2; CASP-2; NEDD-2
UniProt Entry Name
CASP2_HUMAN

NCBI Description

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimer's disease, Huntington's disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

CASP2: Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a p18 subunit and a p12 subunit. Interacts with LRDD. Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle. Belongs to the peptidase C14A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Apoptosis; EC 3.4.22.55

Chromosomal Location of Human Ortholog: 7q34-q35

Cellular Component: cytoplasm; cytosol; membrane; mitochondrion; nucleus

Molecular Function: cysteine-type endopeptidase activity; enzyme binding; protein binding; protein domain specific binding

Biological Process: aging; apoptosis; brain development; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; DNA damage response, signal transduction resulting in induction of apoptosis; germ cell programmed cell death; luteolysis; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; positive regulation of neuron apoptosis; protein processing; regulation of caspase activity

Research Articles on CASP2

Similar Products

Product Notes

The CASP2 casp2 (Catalog #AAA960916) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-452aa; Full Length. The amino acid sequence is listed below: AAPSAGSWST FQHKELMAAD RGRRILGVCG MHPHHQETLK KNRVVLAKQL LLSELLEHLL EKDIITLEMR ELIQAKVGSF SQNVELLNLL PKRGPQAFDA FCEALRETKQ GHLEDMLLTT LSGLQHVLPP LSCDYDLSLP FPVCESCPLY KKLRLSTDTV EHSLDNKDGP VCLQVKPCTP EFYQTHFQLA YRLQSRPRGL ALVLSNVHFT GEKELEFRSG GDVDHSTLVT LFKLLGYDVH VLCDQTAQEM QEKLQNFAQL PAHRVTDSCI VALLSHGVEG AIYGVDGKLL QLQEVFQLFD NANCPSLQNK PKMFFIQACR GDETDRGVDQ QDGKNHAGSP GCEESDAGKE KLPKMRLPTR SDMICGYACL KGTAAMRNTK RGSWYIEALA QVFSERACDM HVADMLVKVN ALIKDREGYA PGTEFHRCKE MSEYCSTLCR HLYLFPGHPP T. It is sometimes possible for the material contained within the vial of "Caspase-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.