ATP2A1 Polyclonal Antibody | anti-ATP2A1 antibody

Anti-ATP2A1 Antibody

Cat. Num. AAA177760

• Gene Names: ATP2A1; ATP2A; SERCA1
• Reactivity: Mouse, Rat; Predicted to work with: Human
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: ATP2A1; Polyclonal Antibody; Anti-ATP2A1 Antibody; Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 ; fast twitch skeletal muscle isoform; AT2A1_HUMAN; ATP2A; ATPase Ca++ transporting cardiac muscle fast twitch 1; ATPase Ca++ transporting fast twitch 1; ATPase; Ca(2+)-transporting fast twitch 1; Calcium pump 1; Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform; Calcium-transporting ATPase sarcoplasmic reticulum type; Endoplasmic reticulum class 1/2 Ca(2+) ATPase; Fast skeletal muscle SR calcium ATPase; OTTHUMP00000162561; OTTHUMP00000162562; Sarcoendoplasmic reticulum calcium ATPase; Sarcoplasmic reticulum Ca(2+)-ATPase 1; Sarcoplasmic/endoplasmic reticulum calcium ATPase 1; SERCA 1; SERCA1; SERCA1 truncated isoform; included; SR Ca(2+) ATPase 1; SR Ca(2+)-ATPase 1; Ca++ transporting; cardiac muscle; fast twitch 1; anti-ATP2A1 antibody

• Reactivity: Mouse, Rat; Predicted to work with: Human
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 869

• Applicable Applications for anti-ATP2A1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A1 (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- SERCA1 ATPase antibody, Western blottingAll lanes: Anti SERCA1 ATPase at 0.5ug/mlLane 1: Rat Skeletal Muscle Tissue Lysate at 50ugLane 2: Mouse Skeletal Muscle Tissue Lysate at 50ugPredicted bind size: 110KDObserved bind size: 110KD)

Immunohistochemistry (IHC)

(Anti- SERCA1 ATPase antibody,IHC(P)IHC(P): Rat Skeletal Muscle Tissue)

Immunohistochemistry (IHC)

(Anti- SERCA1 ATPase antibody, IHC(P)IHC(P): Mouse Skeletal Muscle Tissue)

Related Product Information for anti-ATP2A1 antibody

Description: Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.

References

1. Brandl, C. J., Green, N. M., Korczak, B., MacLennan, D. H. Two Ca(2+) ATPase genes: homologies and mechanistic implications of deduced amino acid sequences. Cell 44: 597-607, 1986. 2. Karpati, G., Charuk, J., Carpenter, S., Jablecki, C., Holland, P. Myopathy caused by a deficiency of Ca(2+)-adenosine triphosphatase in sarcoplasmic reticulum (Brody's disease). Ann. Neurol. 20: 38-49, 1986. 3. Zhang, Y., Fujii, J., Phillips, M. S., Chen, H.-S., Karpati, G., Yee, W.-C., Schrank, B., Cornblath, D. R., Boyland, K. B., MacLennan, D. H. Characterization of cDNA and genomic DNA encoding SERCA1, the Ca(2+)-ATPase of human fast-twitch skeletal muscle sarcoplasmic reticulum, and its elimination as a candidate gene for Brody disease. Gemomics 30: 415-424, 1995.

NCBI and Uniprot Product Information

• NCBI GI #: 554506571
• NCBI GeneID: 487
• NCBI Accession #: NP_001273004.1
• NCBI GenBank Nucleotide #: NM_001286075.1
• UniProt Accession #: O14983; O14984; A8K5J9; B3KY17
• Molecular Weight: 95,199 Da
• NCBI Official Full Name: sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform c
• NCBI Official Synonym Full Names: ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
• NCBI Official Symbol: ATP2A1
• NCBI Official Synonym Symbols: ATP2A; SERCA1
• NCBI Protein Information: sarcoplasmic/endoplasmic reticulum calcium ATPase 1
• UniProt Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
• Protein Family: Sarcoplasmic/endoplasmic reticulum calcium ATPase
• UniProt Gene Name: ATP2A1
• UniProt Synonym Gene Names: SERCA1; SR Ca(2+)-ATPase 1
• UniProt Entry Name: AT2A1_HUMAN

NCBI Description

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in three transcript variants encoding different isoforms. [provided by RefSeq, Oct 2013]

Uniprot Description

ATP2A1: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. Associated with sarcolipin (SLN) and phospholamban (PLN). Increased contractile activity leads to a decrease in SERCA1 expression, while decreased contractile activity leads to an increase in SERCA1 expression. Skeletal muscle, fast twitch muscle (type II) fibers. Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.6.3.8; Endoplasmic reticulum; Hydrolase; Transporter, ion channel; Membrane protein, integral; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16p12.1

Cellular Component: endoplasmic reticulum membrane; ER-Golgi intermediate compartment; I band; integral to membrane; integral to plasma membrane; membrane; mitochondrion; perinuclear region of cytoplasm; sarcoplasmic reticulum; sarcoplasmic reticulum membrane

Molecular Function: ATP binding; calcium ion binding; calcium-transporting ATPase activity; protein binding; protein homodimerization activity

Biological Process: apoptotic mitochondrial changes; calcium ion transport; elevation of endoplasmic reticulum calcium ion concentration; elevation of mitochondrial calcium ion concentration; maintenance of mitochondrion localization; metabolic process; negative regulation of striated muscle contraction; positive regulation of fast-twitch skeletal muscle contraction; reduction of endoplasmic reticulum calcium ion concentration; regulation of striated muscle contraction

Disease: Brody Myopathy