Cyclin-dependent kinase 4 inhibitor C (Cdkn2c) Recombinant Protein | Cdkn2c recombinant protein

Recombinant Mouse Cyclin-dependent kinase 4 inhibitor C (Cdkn2c)

Cat. Num. AAA1446988

• Gene Names: Cdkn2c; p18; INK4c; C77269; p18-INK6; p18INK4c; p18-INK4c
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cyclin-dependent kinase 4 inhibitor C (Cdkn2c); Recombinant Mouse Cyclin-dependent kinase 4 inhibitor C (Cdkn2c); Cdkn2c recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-168, full length protein
• Sequence: MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPNLKDGTGFAVIHDAARAGFLDTVQALLEFQADVNIEDNEGNLPLHLAAKEGHLPVVEFLMKHTACNVGHRNHKGDTAFDLARFYGRNEVISLMEANGVGGATSLQ
• Sequence Length: 168

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Cdkn2c recombinant protein

This protein is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.

NCBI and Uniprot Product Information

• NCBI GI #: 672717917
• NCBI GeneID: 12580
• NCBI Accession #: NP_001288297.1
• NCBI GenBank Nucleotide #: NM_001301368.1
• UniProt Accession #: Q60772
• Molecular Weight: 18,066 Da
• NCBI Official Full Name: cyclin-dependent kinase 4 inhibitor C
• NCBI Official Synonym Full Names: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
• NCBI Official Symbol: Cdkn2c
• NCBI Official Synonym Symbols: p18; INK4c; C77269; p18-INK6; p18INK4c; p18-INK4c
• NCBI Protein Information: cyclin-dependent kinase 4 inhibitor C
• UniProt Protein Name: Cyclin-dependent kinase 4 inhibitor C
• Protein Family: Cyclin-dependent kinase 4 inhibitor
• UniProt Gene Name: Cdkn2c

NCBI Description

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase (cdk) inhibitors, and contains five ankyrin repeats. This protein interacts with both Cdk4 and Cdk6 to inhibit their kinase activities, and prevent their interactions with D-type cyclins, thereby negatively regulating cell division. This gene is differentially expressed in a variety of tissues, and is cell cycle regulated. Deletion of this gene can lead to tumor growth. Maximal expression is observed at the G2/M phase. Alternative splicing and promoter usage results in multiple transript variants. [provided by RefSeq, Aug 2014]

Uniprot Description

Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB.