Putative GDP-L-fucose synthase 2 (GER2) Recombinant Protein | GER2 recombinant protein
Recombinant Arabidopsis thaliana Putative GDP-L-fucose synthase 2 (GER2)
Gene Names
GER2; F2H15.12; F2H15_12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative GDP-L-fucose synthase 2 (GER2); Recombinant Arabidopsis thaliana Putative GDP-L-fucose synthase 2 (GER2); GER2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-328, Full length protein
Sequence
MADNTGSEMKSGSFMLEKSAKIFVAGHRGLVGSAIVRKLQDQGFTNLVLRTHSELDLTSQSDVESFFATEKPVYVILAAAKVGGIHANNTYPADFIGVNLQIQTNVIHSAYTHGVKKLLFLGSSCIYPKFAPQPIPESALLTGPLEPTNEWYAIAKIAGIKMCQAYRLQHQWDAISGMPTNLYGQNDNFHPENSHVLPALMRRFHEAKANNADEVVVWGSGSPLREFLHVDDLADACVFLMDQYSGFEHVNVGSGVEVTIKELAELVKEVVGFKGKLVWDTTKPDGTPRKLMDSSKLASLGWTPKISLKDGLSQTYEWYLENVVQKKQ
Sequence Length
328
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,227 Da
NCBI Official Full Name
NAD(P)-binding Rossmann-fold superfamily protein
NCBI Official Symbol
GER2
NCBI Official Synonym Symbols
F2H15.12; F2H15_12
NCBI Protein Information
NAD(P)-binding Rossmann-fold superfamily protein
UniProt Protein Name
Putative GDP-L-fucose synthase 2
Protein Family
UniProt Gene Name
GER2
UniProt Synonym Gene Names
AtGER2
Uniprot Description
Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.
Similar Products
Product Notes
The GER2 ger2 (Catalog #AAA1423878) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-328, Full length protein. The amino acid sequence is listed below: MADNTGSEMK SGSFMLEKSA KIFVAGHRGL VGSAIVRKLQ DQGFTNLVLR THSELDLTSQ SDVESFFATE KPVYVILAAA KVGGIHANNT YPADFIGVNL QIQTNVIHSA YTHGVKKLLF LGSSCIYPKF APQPIPESAL LTGPLEPTNE WYAIAKIAGI KMCQAYRLQH QWDAISGMPT NLYGQNDNFH PENSHVLPAL MRRFHEAKAN NADEVVVWGS GSPLREFLHV DDLADACVFL MDQYSGFEHV NVGSGVEVTI KELAELVKEV VGFKGKLVWD TTKPDGTPRK LMDSSKLASL GWTPKISLKD GLSQTYEWYL ENVVQKKQ. It is sometimes possible for the material contained within the vial of "Putative GDP-L-fucose synthase 2 (GER2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
