<
Western Blot (WB)
(Western Blot detection against Immunogen (37.11KD).)
Mouse anti-Human ST3GAL2 Monoclonal Antibody
ST3GAL2 (SIAT4-B, ST3Gal II, ST3GalII, ST3GalA.2, SIAT4B, CMP-N-acetylneuraminate-beta-galactosamide- alpha-2,3-sialyltransferase 2, Beta-galactoside alpha-2,3-sialyltransferase 2, Alpha 2,3-ST 2, Gal-NAc6S, Gal-beta-1,3-GalNAc-alpha-2,3- sialyltransferas
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ST3GAL2; Monoclonal Antibody; ST3GAL2 (SIAT4-B; ST3Gal II; ST3GalII; ST3GalA.2; SIAT4B; CMP-N-acetylneuraminate-beta-galactosamide- alpha-2; 3-sialyltransferase 2; Beta-galactoside alpha-2; Alpha 2; 3-ST 2; Gal-NAc6S; Gal-beta-1; 3-GalNAc-alpha-2; 3- sialyltransferas; Anti -ST3GAL2 (SIAT4-B; anti-ST3GAL2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E12
Specificity
Recognizes human ST3GAL2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
HHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEV*
Applicable Applications for anti-ST3GAL2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1-10ug/ml
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1-10ug/ml
Immunogen
Partial recombinant corresponding to aa28-128 from human ST3GAL2 (NP_008858) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.11KD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.11KD).)
Western Blot (WB)
(ST3GAL2 monoclonal antibody, Western Blot analysis of ST3GAL2 expression in K-562.)
Western Blot (WB)
(ST3GAL2 monoclonal antibody, Western Blot analysis of ST3GAL2 expression in K-562.)
Western Blot (WB)
(Western Blot analysis of ST3GAL2 expression in transfected 293T cell line by ST3GAL2 monoclonal antibody.|Lane 1: ST3GAL2 transfected lysate (40.2kD).|Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ST3GAL2 expression in transfected 293T cell line by ST3GAL2 monoclonal antibody.|Lane 1: ST3GAL2 transfected lysate (40.2kD).|Lane 2: Non-transfected lysate.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to ST3GAL2 on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 1-10ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to ST3GAL2 on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 1-10ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged ST3GAL2 is ~0.03ng/ml as a capture antibody)
Testing Data
(Detection limit for recombinant GST tagged ST3GAL2 is ~0.03ng/ml as a capture antibody)
Related Product Information for anti-ST3GAL2 antibody
The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq]
Product Categories/Family for anti-ST3GAL2 antibody
Similar Products
Product Notes
The ST3GAL2 (Catalog #AAA642168) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ST3GAL2 (SIAT4-B, ST3Gal II, ST3GalII, ST3GalA.2, SIAT4B, CMP-N-acetylneuraminate-beta-galactosamide- alpha-2,3-sialyltransferase 2, Beta-galactoside alpha-2,3-sialyltransferase 2, Alpha 2,3-ST 2, Gal-NAc6S, Gal-beta-1,3-GalNAc-alpha-2,3- sialyltransferas reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ST3GAL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1-10ug/ml. Researchers should empirically determine the suitability of the ST3GAL2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HHSMATLPYL DSGALDGTHR VKLVPGYAGL QRLSKERLSG KSCACRRCMG DAGASDWFDS HFDGNISPVW TRENMDLPPD VQRWWMMLQP QFKSHNTNEV *. It is sometimes possible for the material contained within the vial of "ST3GAL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
