Vascular Endothelial Growth Factor Active Protein | rVEGFC active protein

Recombinant Rat Vascular Endothelial Growth Factor Related Protein

Cat. Num. AAA142139

• Gene Names: Vegfa; VPF; Vegf; VEGF-A; VEGF164
• Purity: Greater than 90.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Synonyms: Vascular Endothelial Growth Factor; Recombinant Rat Vascular Endothelial Growth Factor Related Protein; VEGF C Rat; Vascular Endothelial Growth Factor Related Protein Rat Recombinant; VEGF-C; Vascular endothelial growth factor C; VRP; Flt4 ligand; Flt4-L; rVEGFC active protein

• Host: Sf9 Insect Cells
• Purity/Purification: Greater than 90.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Form/Format: Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH
• Sequence Length: 325

• Solubility: It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Biological Activity: Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg.
• Preparation and Storage: Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution VEGF-C should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.Please prevent freeze-thaw cycles.

Related Product Information for rVEGFC active protein

Description: Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.

Introduction: VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGFC cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT -4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A.

Product Categories/Family for rVEGFC active protein

Cytokines and Growth Factors; Growth Factors; VEGF

NCBI and Uniprot Product Information

• NCBI GI #: 160358797
• NCBI GeneID: 83785
• NCBI Accession #: NP_001103804.1
• NCBI GenBank Nucleotide #: NM_001110334.2
• UniProt Accession #: P16612; Q541S6; Q91ZE1; Q9JKX7; Q9QXG6; Q9QXG7
• Molecular Weight: 17,189 Da
• NCBI Official Full Name: vascular endothelial growth factor A isoform 3
• NCBI Official Synonym Full Names: vascular endothelial growth factor A
• NCBI Official Symbol: Vegfa
• NCBI Official Synonym Symbols: VPF; Vegf; VEGF-A; VEGF164
• NCBI Protein Information: vascular endothelial growth factor A; vascular permeability factor
• UniProt Protein Name: Vascular endothelial growth factor A
• Protein Family: Vascular endothelial growth factor
• UniProt Gene Name: Vegfa
• UniProt Synonym Gene Names: Vegf; VEGF-A; VPF
• UniProt Entry Name: VEGFA_RAT

NCBI Description

This gene product is a member of the PDGF/VEGF growth factor family. It is a mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis, endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Also, alternative translation initiation from non-AUG (CUG) and AUG start sites in some transcript variants, give rise to additional isoforms. The expression of some isoforms derived from AUG start codon is affected by a small upstream open reading frame, which is located within an internal ribosome entry site. [provided by RefSeq, Nov 2013]

Uniprot Description

VEGF: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Belongs to the PDGF/VEGF growth factor family. 13 isoforms of the human protein are produced by alternative promoter.

Protein type: Secreted, signal peptide; Cytokine; Motility/polarity/chemotaxis; Secreted

Cellular Component: extracellular space; cell surface; membrane; cytoplasm; extracellular region; basement membrane; secretory granule

Molecular Function: heparin binding; identical protein binding; protein homodimerization activity; growth factor activity; extracellular matrix binding; cytokine activity; platelet-derived growth factor receptor binding; vascular endothelial growth factor receptor 1 binding; vascular endothelial growth factor receptor binding; receptor agonist activity; vascular endothelial growth factor receptor 2 binding; protein heterodimerization activity; fibronectin binding; receptor binding; chemoattractant activity

Biological Process: heart morphogenesis; positive regulation of cell adhesion; positive regulation of positive chemotaxis; macrophage differentiation; cell maturation; positive regulation of receptor internalization; female pregnancy; response to vitamin A; basophil chemotaxis; positive regulation of MAP kinase activity; regulation of cell shape; positive chemotaxis; response to folic acid; positive regulation of mesenchymal cell proliferation; mesoderm development; negative regulation of neuron apoptosis; kidney development; nervous system development; positive regulation of neuroblast proliferation; T-helper 1 type immune response; positive regulation of signal transduction; monocyte differentiation; mRNA stabilization; positive regulation of blood vessel endothelial cell migration; activation of CREB transcription factor; positive regulation of protein amino acid autophosphorylation; regulation of endothelial cell differentiation; positive regulation of vascular permeability; regulation of transcription from RNA polymerase II promoter; patterning of blood vessels; positive regulation of peptidyl-tyrosine phosphorylation; eye photoreceptor cell development; positive regulation of angiogenesis; camera-type eye morphogenesis; branching morphogenesis of a tube; cell migration during sprouting angiogenesis; cardiac muscle fiber development; positive regulation of cell division; positive regulation of axon extension involved in axon guidance; activation of protein kinase activity; neuron development; blood vessel morphogenesis; endothelial cell migration; positive regulation of transcription from RNA polymerase II promoter; positive regulation of endothelial cell proliferation; regulation of cGMP metabolic process; response to progesterone stimulus; surfactant homeostasis; alveolus development; positive regulation of epithelial cell proliferation; negative regulation of apoptosis; lactation; post-embryonic camera-type eye development; wound healing; positive regulation of smooth muscle cell proliferation; negative regulation of caspase activity; negative regulation of transcription from RNA polymerase II promoter; response to estradiol stimulus; positive regulation of vascular endothelial growth factor receptor signaling pathway; induction of positive chemotaxis; epithelial cell differentiation; positive regulation of focal adhesion formation; vasculature development; ovarian follicle development; positive regulation of cell proliferation; lymphangiogenesis; negative regulation of programmed cell death; angiogenesis; cell differentiation; negative regulation of bone resorption; aging; blood vessel development; cell migration; in utero embryonic development; lumen formation; positive regulation of cell motility; positive regulation of peptidyl-serine phosphorylation; cell proliferation; positive regulation of protein kinase B signaling cascade; positive regulation of protein complex assembly; response to hypoxia; artery morphogenesis; blood vessel remodeling; negative regulation of cell-cell adhesion; sprouting angiogenesis; response to cold; positive regulation of protein amino acid phosphorylation; vascular endothelial growth factor receptor signaling pathway; hyaluronan metabolic process; positive regulation of cell migration; growth; lung development