Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interferon-Alpha 2a Polyclonal Antibody | anti-IFNA2A antibody

Polyclonal Rabbit Anti Human Interferon-Alpha 2a

Gene Names
IFNA2; IFNA; INFA2; IFNA2B; IFN-alphaA
Purity
Greater than 98%.
Purified IgG prepared by affinity chromatography on protein G.
Synonyms
Interferon-Alpha 2a; Polyclonal Antibody; Polyclonal Rabbit Anti Human Interferon-Alpha 2a; IFN a 2a Antibody; Interferon a 2a Polyclonal Rabbit Anti-Human Antibody; Leukocyte interferon; B cell interferon; Type I interferon; IFNA2; IFN-a 2a; anti-IFNA2A antibody
Ordering
For Research Use Only!
Clonality
Polyclonal
Purity/Purification
Greater than 98%.
Purified IgG prepared by affinity chromatography on protein G.
Form/Format
Lyophilized from a sterile filtered (0.2 um) solution containing phosphate buffered saline.
Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Sequence Length
188
Solubility
Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.
Immunogen
IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants.
Related Product Information for anti-IFNA2A antibody
Introduction: IFN-alpha is produced by macrophages and has antiviral activities. Interferon stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase.
Product Categories/Family for anti-IFNA2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,550 Da
NCBI Official Full Name
interferon alpha-2
NCBI Official Synonym Full Names
interferon, alpha 2
NCBI Official Symbol
IFNA2
NCBI Official Synonym Symbols
IFNA; INFA2; IFNA2B; IFN-alphaA
NCBI Protein Information
interferon alpha-2; IFN-alpha-2; alpha-2a interferon; interferon alpha 2a; interferon alpha 2b; interferon alpha A; leIF A
UniProt Protein Name
Interferon alpha-2
UniProt Gene Name
IFNA2
UniProt Synonym Gene Names
IFNA2A; IFNA2B; IFNA2C; IFN-alpha-2; LeIF A
UniProt Entry Name
IFNA2_HUMAN

NCBI Description

This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold. [provided by RefSeq, Jun 2011]

Uniprot Description

IFNA2: Produced by macrophages, IFN-alpha have antiviral activities. Belongs to the alpha/beta interferon family.

Protein type: Secreted; Membrane protein, integral; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 9p22

Cellular Component: extracellular space; extracellular region

Molecular Function: protein binding; interferon-alpha/beta receptor binding; cytokine activity

Biological Process: cell surface receptor linked signal transduction; cell-cell signaling; negative regulation of virion penetration into host cell; apoptosis; cytokine and chemokine mediated signaling pathway; innate immune response; blood coagulation; inflammatory response; negative regulation of transcription, DNA-dependent; defense response to virus; negative regulation of T cell differentiation; positive regulation of tyrosine phosphorylation of Stat3 protein

Research Articles on IFNA2A

Similar Products

Product Notes

The IFNA2A ifna2 (Catalog #AAA141029) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: CDLPQTHSLG SRRTLMLLAQ MRKISLFSCL KDRHDFGFPQ EEFGNQFQKA ETIPVLHEMI QQIFNLFSTK DSSAAWDETL LDKFYTELYQ QLNDLEACVI QGVGVTETPL MNEDSILAVR KYFQRITLYL KEKKYSPCAW EVVRAEIMRS FSLSTNLQES LRSKE. It is sometimes possible for the material contained within the vial of "Interferon-Alpha 2a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.