Interferon alpha-2 Recombinant Protein | IFNA2 recombinant protein

Recombinant Human Interferon alpha-2

Cat. Num. AAA1036500

• Gene Names: IFNA2; IFNA; INFA2; IFNA2B; IFN-alphaA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interferon alpha-2; Recombinant Human Interferon alpha-2; Interferon alpha-A; LeIF A; IFNA2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-188aa; Full Length
• Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
• Sequence Length: 188

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for IFNA2 recombinant protein

Produced by macrophages, IFN-alpha have antiviral activities.

Product Categories/Family for IFNA2 recombinant protein

Cancer

References

Human leukocyte interferon produced by E. coli is biologically active.Goeddel D.V., Yelverton E., Ullrich A., Heyneker H.L., Miozzari G., Holmes W., Seeburg P.H., Dull T.J., May L., Stebbing N., Crea R., Maeda S., McCandliss R., Sloma A., Tabor J.M., Gross M., Familletti P.C., Pestka S.Nature 287:411-416(1980) The structure of eight distinct cloned human leukocyte interferon cDNAs.Goeddel D.V., Leung D.W., Dull T.J., Gross M., Lawn R.M., McCandliss R., Seeburg P.H., Ullrich A., Yelverton E., Gray P.W.Nature 290:20-26(1981) DNA sequence of a major human leukocyte interferon gene.Lawn R.M., Gross M., Houck C.M., Franke A.E., Gray P.V., Goeddel D.V.Proc. Natl. Acad. Sci. U.S.A. 78:5435-5439(1981) Cloning of human leukocyte interferon cDNA and a strategy for its production in E. coli.Oliver G., Balbas P., Valle F., Soberon X., Bolivar F.Rev. Latinoam. Microbiol. 27:141-150(1985) A defective retroviral vector encoding human interferon alpha 2 can transduce human leukemic cell lines.Austruy E., Bagnis C., Carbuccia N., Maroc C., Birg F., Dubreuil P., Mannoni P., Chabannon C.Cancer Gene Ther. 5:247-256(1998) Heterologous expression, immunochemical and computational analysis of recombinant human interferon alpha 2b.Gull I., Samra Z.Q., Aslam M.S., Athar M.A.Springerplus 2:264-264(2013) Hanif K., Noor S., Naveed Y., Bashir B., Hussain T., Kanwal N. Intermolecular interactions in a 44 kDa interferon-receptor complex detected by asymmetric reverse-protonation and two-dimensional NOESY.Nudelman I., Akabayov S.R., Schnur E., Biron Z., Levy R., Xu Y., Yang D., Anglister J.Biochemistry 49:5117-5133(2010) The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 11067751
• NCBI GeneID: 3440
• NCBI Accession #: NP_000596.2
• NCBI GenBank Nucleotide #: NM_000605.3
• UniProt Accession #: P01563; P01564; Q14606; Q6DJX8; Q96KI6; H2DF54; H2DF55
• Molecular Weight: 21.2 kDa
• NCBI Official Full Name: interferon alpha-2
• NCBI Official Synonym Full Names: interferon, alpha 2
• NCBI Official Symbol: IFNA2
• NCBI Official Synonym Symbols: IFNA; INFA2; IFNA2B; IFN-alphaA
• NCBI Protein Information: interferon alpha-2
• UniProt Protein Name: Interferon alpha-2
• Protein Family: Interferon
• UniProt Gene Name: IFNA2
• UniProt Synonym Gene Names: IFNA2A; IFNA2B; IFNA2C; IFN-alpha-2; LeIF A
• UniProt Entry Name: IFNA2_HUMAN

NCBI Description

This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold. [provided by RefSeq, Jun 2011]

Uniprot Description

IFNA2: Produced by macrophages, IFN-alpha have antiviral activities. Belongs to the alpha/beta interferon family.

Protein type: Secreted; Membrane protein, integral; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 9p22

Cellular Component: extracellular region; extracellular space

Molecular Function: cytokine activity; interferon-alpha/beta receptor binding; protein binding

Biological Process: adaptive immune response; apoptosis; B cell differentiation; B cell proliferation; blood coagulation; cell surface receptor linked signal transduction; cell-cell signaling; cytokine and chemokine mediated signaling pathway; defense response to virus; humoral immune response; inflammatory response; innate immune response; natural killer cell activation during immune response; negative regulation of T cell differentiation; negative regulation of transcription, DNA-dependent; negative regulation of virion penetration into host cell; positive regulation of peptidyl-serine phosphorylation of STAT protein; positive regulation of phosphorylation; positive regulation of transcription, DNA-dependent; positive regulation of tyrosine phosphorylation of Stat3 protein; response to exogenous dsRNA; T cell activation during immune response