Adenosine deaminase (ADA) Recombinant Protein | ADA recombinant protein
Recombinant Chicken Adenosine deaminase (ADA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Adenosine deaminase (ADA); Recombinant Chicken Adenosine deaminase (ADA); ADA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-357, Full length protein
Sequence
MERGVRVFGEPKVELHIHLDGAIRPETILHFGKKRGVPLPGSTVDELMKHVSYQTPLSLKLFLEKFNHYMPAIAGDREAVRRIAYELVETKAKEGVVYVEVRYSPHLLANCRVEPIPWGQAEGDLTPEEVVNLVNQGLQDGERNFRIKARSILCCMRHMPSWSPEVVELCKKYQNNSVVAIDLAGDELLMASSDHKAAYEEAERCGIHRTVHAGEAGPATMIKEAVYLLKAERIGHGYHVLEDPELYRELLRTRMHFEVCPWSSYLTGACLPDFRKHPVVQFKKDQANYSINTDDPLIFNSNIDKDYGIVKEYMDFTEEDFKRVNINAAQSSFLPEKEKQELLNTLYEAYGMVPATS
Sequence Length
357
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ADA recombinant protein
This gene encodes an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,679 Da
NCBI Official Full Name
adenosine deaminase
NCBI Official Synonym Full Names
adenosine deaminase
NCBI Official Symbol
ADA
NCBI Protein Information
adenosine deaminase
UniProt Protein Name
Adenosine deaminase
Protein Family
UniProt Gene Name
ADA
Uniprot Description
Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. May act as a positive regulator of T-cell coactivation ().
Research Articles on ADA
Similar Products
Product Notes
The ADA ada (Catalog #AAA1403245) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-357, Full length protein. The amino acid sequence is listed below: MERGVRVFGE PKVELHIHLD GAIRPETILH FGKKRGVPLP GSTVDELMKH VSYQTPLSLK LFLEKFNHYM PAIAGDREAV RRIAYELVET KAKEGVVYVE VRYSPHLLAN CRVEPIPWGQ AEGDLTPEEV VNLVNQGLQD GERNFRIKAR SILCCMRHMP SWSPEVVELC KKYQNNSVVA IDLAGDELLM ASSDHKAAYE EAERCGIHRT VHAGEAGPAT MIKEAVYLLK AERIGHGYHV LEDPELYREL LRTRMHFEVC PWSSYLTGAC LPDFRKHPVV QFKKDQANYS INTDDPLIFN SNIDKDYGIV KEYMDFTEED FKRVNINAAQ SSFLPEKEKQ ELLNTLYEAY GMVPATS. It is sometimes possible for the material contained within the vial of "Adenosine deaminase (ADA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
