Meteorin-like protein (Metrnl) Recombinant Protein | Metrnl recombinant protein

Recombinant Rat Meteorin-like protein (Metrnl)

Cat. Num. AAA1396091

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Meteorin-like protein (Metrnl); Recombinant Rat Meteorin-like protein (Metrnl); Metrnl recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 46-311. Full length of the mature protein.
• Sequence: QYSSDLCSWKGSGLTREAHSKEVEQVYLRCSAGSVEWMYPTGALIVNLRPNTFSPAQNLTVCIKPFRDSSGANIYLEKTGELRLLVRDVRGEPGQVQCFSLEQGGLFVEATPQQDISRRTTGFQYELMSGQRGLDLHVLSAPCRPCSDTEVLLAICTSDFVVRGFIEDVTHVPEQQVSVIHLRVSRLHRQKSRVFQPAPEDSGHWLGHVTTLLQCGVRPGHGEFLFTGHVHFGEAQLGCAPRFSDFQKMYRKAEERGINPCEINME
• Sequence Length: 311

• Species: Rattus norvegicus (Rat)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Metrnl recombinant protein

Hormone induced following exercise or cold exposure that promotes energy expenditure. Induced either in the skeletal muscle after exercise or in adipose tissue following cold exposure and is present in the circulation. Able to stimulate energy expenditure associated with the browning of the white fat depots and improves glucose tolerance. Does not promote an increase in a thermogenic gene program via direct action on adipocytes, but acts by stimulating several immune cell subtypes to enter the adipose tissue and activate their prothermogenic actions. Stimulates an eosinophil-dependent increase in IL4 expression and promotes alternative activation of adipose tissue macrophages, which are required for the increased expression of the thermogenic and anti-inflammatory gene programs in fat. Required for some cold-induced thermogenic responses, suggesting a role in metabolic adaptations to cold temperatures.

Product Categories/Family for Metrnl recombinant protein

Cell Biology

References

"Subfatin is a novel adipokine and unlike Meteorin in adipose and brain expression." Li Z.Y., Zheng S.L., Wang P., Xu T.Y., Guan Y.F., Zhang Y.J., Miao C.Y. CNS Neurosci. Ther. 20:344-354(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 62078941
• NCBI GeneID: 316842
• NCBI Accession #: NP_001014126.1
• NCBI GenBank Nucleotide #: NM_001014104.1
• UniProt Accession #: Q5RJL6
• Molecular Weight: 33.8 kDa
• NCBI Official Full Name: meteorin-like protein
• NCBI Official Synonym Full Names: meteorin-like, glial cell differentiation regulator
• NCBI Official Symbol: Metrnl
• NCBI Protein Information: meteorin-like protein
• UniProt Protein Name: Meteorin-like protein
• Protein Family: Meteorin-like protein
• UniProt Gene Name: Metrnl

Uniprot Description

Hormone induced following exercise or cold exposure that promotes energy expenditure. Induced either in the skeletal muscle after exercise or in adipose tissue following cold exposure and is present in the circulation. Able to stimulate energy expenditure associated with the browning of the white fat depots and improves glucose tolerance. Does not promote an increase in a thermogenic gene program via direct action on adipocytes, but acts by stimulating several immune cell subtypes to enter the adipose tissue and activate their prothermogenic actions. Stimulates an eosinophil-dependent increase in IL4 expression and promotes alternative activation of adipose tissue macrophages, which are required for the increased expression of the thermogenic and anti-inflammatory gene programs in fat. Required for some cold-induced thermogenic responses, suggesting a role in metabolic adaptations to cold temperatures ().