Protein UL141 (UL141) Recombinant Protein | UL141 recombinant protein
Recombinant Human cytomegalovirus Protein UL141 (UL141), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein UL141 (UL141); Recombinant Human cytomegalovirus Protein UL141 (UL141); partial; UL141 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
37-278aa; Extracellular Domain
Sequence
DIAEKMWAENYETTSPAPVLVAEGEQVTIPCTVMTHSWPMVSIRARFCRSHDGSDELILDAVKGHRLMNGLQYRLPYATWNFSQLHLGQIFSLTFNVSTDTAGMYECVLRNYSHGLIMQRFVILTQLETLSRPDEPCCTPALGRYSLGDQIWSPTPWRLRNHDCGMYRGFQRNYFYIGRADAEDCWKPACPDEEPDRCWTVIQRYRLPGDCYRSQPHPPKFLPVTPAPPADIDTGMSPWATR
Species
Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,918 Da
NCBI Official Full Name
membrane glycoprotein UL141
NCBI Official Symbol
UL141
NCBI Protein Information
type 1 membrane protein; inhibits NK cell cytotoxicity; sequesters CD155; acts on activating receptor DNAM-1, CD96; involved in immune regulation
UniProt Protein Name
Protein UL141
Protein Family
UniProt Gene Name
UL141
Uniprot Description
Evasion of NK cell killing. Blocks surface expression of PVR which is a ligand for NK cell-activating receptors. Binds human PVR in the endoplasmic reticulum and prevents its maturation and transport to the cell surface. Targets also the natural killer cell activating ligand NECTIN2 for proteasome-mediated degradation. Additionally promotes intracellular retention of TNFRSF10A/TRAIL-R1 and TNFRSF10B/TRAIL-R2 and thus downregulates their cell surface expression.
Research Articles on UL141
Similar Products
Product Notes
The UL141 ul141 (Catalog #AAA1370484) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 37-278aa; Extracellular Domain. The amino acid sequence is listed below: DIAEKMWAEN YETTSPAPVL VAEGEQVTIP CTVMTHSWPM VSIRARFCRS HDGSDELILD AVKGHRLMNG LQYRLPYATW NFSQLHLGQI FSLTFNVSTD TAGMYECVLR NYSHGLIMQR FVILTQLETL SRPDEPCCTP ALGRYSLGDQ IWSPTPWRLR NHDCGMYRGF QRNYFYIGRA DAEDCWKPAC PDEEPDRCWT VIQRYRLPGD CYRSQPHPPK FLPVTPAPPA DIDTGMSPWA TR. It is sometimes possible for the material contained within the vial of "Protein UL141 (UL141), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
