Tripartite motif-containing protein 69 (Trim69) Recombinant Protein | Trim69 recombinant protein
Recombinant Rat Tripartite motif-containing protein 69 (Trim69)
Gene Names
Trim69; Rnf36
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tripartite motif-containing protein 69 (Trim69); Recombinant Rat Tripartite motif-containing protein 69 (Trim69); Trim69 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-499, full length protein
Sequence
MEVSSRPPSNFDPGNYVEVSDPSTHLPSKVVIQDITTELHCPLCNDWFRDPLMLTCGHNFCQACIQNYWKMQAKETFCPECKMLCQYSNCTFNLVLEKLVEKIKRLPLLKGHPQCPEHGENLKLFSKPDGKMICFQCKDARLSMGQSKDFLQISEAVRFFTEELAIYQSQLQTTLKELQSLRTMQKDAIAAYKDNKIQLQQNLSLEFLKLHQFLHNKEKDILNDLRDEGKVLNEEMDANLNQIQEQCLLAKDMLANIQARMEQQNSFDFLTDITKLLENMEKGMKTLVPRQLISKKLSLGRFKGPIQYTIWREMQSILSPGPSQLTLDPKTAHPNLVLSNSRTSVCHGDVKQVMPDDPERFDSSVAVLGSKGFTSGKWYWEIEVAKKTKWTIGIVRESIIRKGSCPLTPEQGFWLLRLRNQTDLKALDLPSCSLNLGDLRRVGVYLDYEGGQVSFYNATNMTHLYTFTSVFLEKLFPYLCPCLNDGGENKEPLHIVHPQ
Sequence Length
499
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Trim69 recombinant protein
This gene encodes a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,215 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM69
NCBI Official Synonym Full Names
tripartite motif-containing 69
NCBI Official Symbol
Trim69
NCBI Official Synonym Symbols
Rnf36
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM69
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM69
Protein Family
UniProt Gene Name
Trim69
UniProt Synonym Gene Names
Rnf36
Uniprot Description
May have E3 ubiquitin-protein ligase activity. May play a role in apoptosis.
Similar Products
Product Notes
The Trim69 trim69 (Catalog #AAA1335730) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-499, full length protein. The amino acid sequence is listed below: MEVSSRPPSN FDPGNYVEVS DPSTHLPSKV VIQDITTELH CPLCNDWFRD PLMLTCGHNF CQACIQNYWK MQAKETFCPE CKMLCQYSNC TFNLVLEKLV EKIKRLPLLK GHPQCPEHGE NLKLFSKPDG KMICFQCKDA RLSMGQSKDF LQISEAVRFF TEELAIYQSQ LQTTLKELQS LRTMQKDAIA AYKDNKIQLQ QNLSLEFLKL HQFLHNKEKD ILNDLRDEGK VLNEEMDANL NQIQEQCLLA KDMLANIQAR MEQQNSFDFL TDITKLLENM EKGMKTLVPR QLISKKLSLG RFKGPIQYTI WREMQSILSP GPSQLTLDPK TAHPNLVLSN SRTSVCHGDV KQVMPDDPER FDSSVAVLGS KGFTSGKWYW EIEVAKKTKW TIGIVRESII RKGSCPLTPE QGFWLLRLRN QTDLKALDLP SCSLNLGDLR RVGVYLDYEG GQVSFYNATN MTHLYTFTSV FLEKLFPYLC PCLNDGGENK EPLHIVHPQ. It is sometimes possible for the material contained within the vial of "Tripartite motif-containing protein 69 (Trim69), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
