Western Blot (WB)
(WB Suggested Anti-TRIM69 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Rabbit TRIM69 Polyclonal Antibody | anti-TRIM69 antibody
TRIM69 antibody - N-terminal region
Gene Names
TRIM69; Trif; HSD34; RNF36; HSD-34
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRIM69; Polyclonal Antibody; TRIM69 antibody - N-terminal region; anti-TRIM69 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLSQLQ
Sequence Length
341
Applicable Applications for anti-TRIM69 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM69
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TRIM69 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Western Blot (WB)
(WB Suggested Anti-TRIM69 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Related Product Information for anti-TRIM69 antibody
This is a rabbit polyclonal antibody against TRIM69. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TRIM69 is a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis.This gene encodes a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Target Description: TRIM69 is a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis.This gene encodes a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Product Categories/Family for anti-TRIM69 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM69 isoform b
NCBI Official Synonym Full Names
tripartite motif containing 69
NCBI Official Symbol
TRIM69
NCBI Official Synonym Symbols
Trif; HSD34; RNF36; HSD-34
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM69
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM69
Protein Family
UniProt Gene Name
TRIM69
UniProt Synonym Gene Names
RNF36
UniProt Entry Name
TRI69_HUMAN
NCBI Description
This gene encodes a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]
Uniprot Description
TRIM69: May play a role in apoptosis. Belongs to the TRIM/RBCC family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Ubiquitin conjugating system
Chromosomal Location of Human Ortholog: 15q21.1
Cellular Component: cytoplasm; plasma membrane; nuclear speck; nucleus
Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity
Biological Process: apoptosis; protein ubiquitination
Research Articles on TRIM69
Similar Products
Product Notes
The TRIM69 trim69 (Catalog #AAA3202274) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM69 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM69 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIM69 trim69 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NKLHLQQHVS MEFLKLHQFL HSKEKDILTE LREEGKALNE EMELNLSQLQ. It is sometimes possible for the material contained within the vial of "TRIM69, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
