Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitogen-activated protein kinase kinase kinase kinase 3 (Map4k3) Recombinant Protein | Map4k3 recombinant protein

Recombinant Mouse Mitogen-activated protein kinase kinase kinase kinase 3 (Map4k3) , partial

Gene Names
Map4k3; Glk; MEKKK3; MEKKK 3; MAPKKKK3; RAB8IPL1; 4833416M01Rik; 4833416M07Rik; 9530052P13Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitogen-activated protein kinase kinase kinase kinase 3 (Map4k3); Recombinant Mouse Mitogen-activated protein kinase kinase kinase kinase 3 (Map4k3); partial; Map4k3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
556-867. Partial
Sequence
PLKIHCATSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSVSGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFAVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIEFPMPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDAPQTSVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDNTRIFRLLGSDRV
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Map4k3 recombinant protein
This gene encodes a member of the Ste20 family of serine
threonine protein kinases. The protein belongs to the subfamily that consists of members, such as germinal center kinase (GCK), that are characterized by an N-terminal catalytic domain and C-terminal regulatory domain. The kinase activity of the encoded protein can be stimulated by UV radiation and tumor necrosis factor-alpha. The protein specifically activates the c-Jun N-terminal kinase (JNK) signaling pathway. Evidence suggests that it functions upstream of mitogen-activated protein kinase kinase kinase 1 (MEKK1). This gene previously was referred to as RAB8-interacting protein-like 1 (RAB8IPL1), but it has been renamed mitogen-activated protein kinase kinase kinase kinase 3 (MAP4K3).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101,119 Da
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase kinase 3 isoform 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase kinase 3
NCBI Official Symbol
Map4k3
NCBI Official Synonym Symbols
Glk; MEKKK3; MEKKK 3; MAPKKKK3; RAB8IPL1; 4833416M01Rik; 4833416M07Rik; 9530052P13Rik
NCBI Protein Information
mitogen-activated protein kinase kinase kinase kinase 3
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase kinase 3
UniProt Gene Name
Map4k3
UniProt Synonym Gene Names
GLK; MEK kinase kinase 3; MEKKK 3

Uniprot Description

May play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway ().

Similar Products

Product Notes

The Map4k3 map4k3 (Catalog #AAA1310724) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 556-867. Partial. The amino acid sequence is listed below: PLKIHCATSW INPDTRDQYL IFGAEEGIYT LNLNELHETS MEQLFPRRCT WLYVMNNCLL SVSGKASQLY SHNLPGLFDY ARQMQKLPVA IPAHKLPDRI LPRKFAVSAK IPETKWCQKC CVVRNPYTGH KYLCGALQTS IVLLEWVEPM QKFMLIKHIE FPMPCPLRMF EMLVVPEQEY PLVCVGVSRG RDFNQVVRFE TVNPNSTSSW FTESDAPQTS VTHVTQLERD TILVCLDCCI KIVNLQGRLK SSRKLSSELT FDFQIESIVC LQDSVLAFWK HGMQGRSFRS NEVTQEISDN TRIFRLLGSD RV . It is sometimes possible for the material contained within the vial of "Mitogen-activated protein kinase kinase kinase kinase 3 (Map4k3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.