Zinc finger protein PLAG1 (PLAG1) Recombinant Protein | PLAG1 recombinant protein

Recombinant Human Zinc finger protein PLAG1 (PLAG1)

Cat. Num. AAA1296874

• Gene Names: PLAG1; PSA; SGPA; ZNF912
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Zinc finger protein PLAG1 (PLAG1); Recombinant Human Zinc finger protein PLAG1 (PLAG1); PLAG1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-500, Full length protein
• Sequence: MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYLMELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSAAFTSSLSTSTTLPRFHQAFQ
• Sequence Length: 500

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for PLAG1 recombinant protein

Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization signals. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 167857796
• NCBI GeneID: 5324
• NCBI Accession #: NP_001108106.1
• NCBI GenBank Nucleotide #: NM_001114634.1
• UniProt Accession #: Q6DJT9; Q59GH8; Q9Y4L2; B4DLC2
• Molecular Weight: 46,474 Da
• NCBI Official Full Name: zinc finger protein PLAG1 isoform a
• NCBI Official Synonym Full Names: PLAG1 zinc finger
• NCBI Official Symbol: PLAG1
• NCBI Official Synonym Symbols: PSA; SGPA; ZNF912
• NCBI Protein Information: zinc finger protein PLAG1
• UniProt Protein Name: Zinc finger protein PLAG1
• Protein Family: Zinc finger protein
• UniProt Gene Name: PLAG1

NCBI Description

Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization signals. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Transcription factor whose activation results in up-regulation of target genes, such as IGFII, leading to uncontrolled cell proliferation: when overexpressed in cultured cells, higher proliferation rate and transformation are observed. Other target genes such as CRLF1, CRABP2, CRIP2, PIGF are strongly induced in cells with PLAG1 induction. Proto-oncogene whose ectopic expression can trigger the development of pleomorphic adenomas of the salivary gland and lipoblastomas. Overexpression is associated with up-regulation of IGFII, is frequently observed in hepatoblastoma, common primary liver tumor in childhood. Cooperates with CBFB-MYH11, a fusion gene important for myeloid leukemia.