HLA class I histocompatibility antigen, alpha chain E (HLA-E) Recombinant Protein | HLA-E recombinant protein

Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E), partial

Cat. Num. AAA1243965

• Gene Names: HLA-E; QA1; HLA-6.2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: HLA class I histocompatibility antigen; alpha chain E (HLA-E); Recombinant Human HLA class I histocompatibility antigen; partial; MHC class I antigen E; HLA-E recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 22-305aa; Extracellular Domain (Old version, reference link: https://www.uniprot.org/uniprot/P13747.fasta?version=188)
• Sequence: GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for HLA-E recombinant protein

Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Product Categories/Family for HLA-E recombinant protein

Immunology

References

Isolation and nucleotide sequence of a cDNA clone encoding a novel HLA class I gene.Mizuno S., Trapani J.A., Koller B.H., Dupont B., Yang S.Y.J. Immunol. 140:4024-4030(1988) Cell surface expression of HLA-E interaction with human beta-2 microglobulin and allelic differences.Ulbrecht M., Courturier A., Martinozzi S., Pla M., Srivastava R., Peterson P.A., Weiss E.H.3.0.CO;2-6>Eur. J. Immunol. 29:537-547(1999) HLA-E, F, and G polymorphism genomic sequence defines new variation spanning the nonclassical class I genes.Ishitani A., Miki A., Williams L.M., Moore Y., Geraghty D.E.Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H. HLA-E. A novel HLA class I gene expressed in resting T lymphocytes.Koller B.H., Geraghty D.E., Shimizu Y., Demars R., Orr H.T.J. Immunol. 141:897-904(1988) Ulbrecht M.A new variant of HLA-E*010303 with three synonymous mutations.He X., Xu L., Liu Y., Zeng Y.Cloning of HLA-E cDNA from activated peripheral leukocytes.He X., Xu L., Liu Y., Zeng Y.Polymorphism in the human class I MHC locus HLA-E in Japanese.Ohya K., Kondo K., Mizuno S.Immunogenetics 32:205-209(1990) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Structural features impose tight peptide binding specificity in the nonclassical MHC molecule HLA-E.O'Callaghan C.A., Tormo J., Willcox B.E., Braud V.M., Jakobsen B.K., Stuart D.I., McMichael A.J., Bell J.I., Jones E.Y.Mol. Cell 1:531-541(1998) Definitive high resolution typing of HLA-E allelic polymorphisms identifying potential errors in existing allele data.Grimsley C., Kawasaki A., Gassner C., Sageshima N., Nose Y., Hatake K., Geraghty D.E., Ishitani A.Tissue Antigens 60:206-212(2002)

NCBI and Uniprot Product Information

• NCBI GI #: 62912479
• NCBI GeneID: 3133
• NCBI Accession #: NP_005507.3
• NCBI GenBank Nucleotide #: NM_005516.5
• UniProt Accession #: P13747; Q30169; Q9BT83; Q9GIY7; Q9GIY8
• Molecular Weight: 36.7 kDa
• NCBI Official Full Name: HLA class I histocompatibility antigen, alpha chain E
• NCBI Official Synonym Full Names: major histocompatibility complex, class I, E
• NCBI Official Symbol: HLA-E
• NCBI Official Synonym Symbols: QA1; HLA-6.2
• NCBI Protein Information: HLA class I histocompatibility antigen, alpha chain E
• UniProt Protein Name: HLA class I histocompatibility antigen, alpha chain E
• Protein Family: HLA class I histocompatibility antigen
• UniProt Gene Name: HLA-E
• UniProt Synonym Gene Names: HLA-6.2; HLAE
• UniProt Entry Name: HLAE_HUMAN

NCBI Description

HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. [provided by RefSeq, Jul 2008]

Uniprot Description

HLA-E: Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules. Belongs to the MHC class I family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cell surface; early endosome membrane; Golgi membrane; MHC class I protein complex; phagocytic vesicle membrane; plasma membrane

Molecular Function: beta-2-microglobulin binding; MHC class I protein binding; natural killer cell lectin-like receptor binding; peptide antigen binding; receptor binding

Biological Process: adaptive immune response; antibacterial humoral response; antigen processing and presentation of endogenous peptide antigen via MHC class Ib; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; antigen processing and presentation of peptide antigen via MHC class I; cytokine and chemokine mediated signaling pathway; defense response to Gram-positive bacterium; innate immune response; positive regulation of immunoglobulin secretion; positive regulation of interleukin-13 production; positive regulation of interleukin-4 production; positive regulation of natural killer cell mediated immunity; positive regulation of T cell mediated cytotoxicity; positive regulation of TRAIL production; positive regulation of tumor necrosis factor production; protection from natural killer cell mediated cytotoxicity; regulation of immune response; regulation of natural killer cell mediated immunity