Probable peptidoglycan biosynthesis protein MurJ (murJ) Recombinant Protein | murJ recombinant protein

Recombinant Escherichia coli Probable peptidoglycan biosynthesis protein MurJ (murJ), partial

Cat. Num. AAA1226737

• Gene Names: murJ; ECK1054; JW1056; mviN; mviS; yceN
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable peptidoglycan biosynthesis protein MurJ (murJ); Recombinant Escherichia coli Probable peptidoglycan biosynthesis protein MurJ (murJ); partial; murJ recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-511
• Sequence: MNLLKSLAAVSSMTMFSRVLGFARDAIVARIFGAGMATDAFFVAFKLPNLLRRIFAEGAFSQAFVPILAEYKSKQGEDATRVFVSYVSGLLTLALAVVTVAGMLAAPWVIMVTAPGFADTADKFALTSQLLKITFPYILLISLASLVGAILNTWNRFSIPAFAPTLLNISMIGFALFAAPYFNPPVLALAWAVTVGGVLQLVYQLPHLKKIGMLVLPRINFHDAGAMRVVKQMGPAILGVSVSQISLIINTIFASFLASGSVSWMYYADRLMEFPSGVLGVALGTILLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFDALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLILTQLMNLAFIGPLKHAGLSLSIGLAACLNASLLYWQLRKQKIFTPQPGWMAFLLRLVVAVLVMSGVLLGMLHIMPEWSLGTMPWRLLRLMAVVLAGIAAYFAALAVLGFKVKEFARRTV
• Sequence Length: 511

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16129032
• NCBI GeneID: 945487
• NCBI Accession #: NP_415587.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0AF16; P75932
• Molecular Weight: 55,267 Da
• NCBI Official Full Name: putative lipid II flippase
• NCBI Official Symbol: murJ
• NCBI Official Synonym Symbols: ECK1054; JW1056; mviN; mviS; yceN
• NCBI Protein Information: putative lipid II flippase
• UniProt Protein Name: Lipid II flippase MurJ
• Protein Family: Putative lipid II flippase
• UniProt Gene Name: murJ

NCBI Description

murJ(yceN) is an essental gene and conditional lethal mutants sweel and burst and acumulate the murein intermediate polyprenyl diphosphate-N-acetylmuramic acid-(pentapeptide)-N-acetyl-glucosamine at the non-permissive temperature (Inoue, 2008). murJ(yceN) was identified as one of two ORFs adjacent to the flg locus in a region originally named mviS, then renamed mviN and mviM when sequenced; mviMN was thought to be required for mouse virulence in Salmonella, but the mviMN deletion in ST39 also removed flgM (Carsiotis, 1989). flgM was later shown to be able to complement the mviS phenotype, and thus flgM is the real mouse virulence gene in this region of the Salmonella chromosome not mviS (Schmitt, 1994). [More information is available at EcoGene: EG13880]. MurJ is an essential gene involved in murein synthesis as the flippase responsible for transport of lipid II from the inner face of the inner membrane to the outer face for polymerization . [More information is available at EcoCyc: G6561].

Uniprot Description

Involved in peptidoglycan biosynthesis. Transports lipid-linked peptidoglycan precursors from the inner to the outer leaflet of the cytoplasmic membrane.