Pre-mRNA-processing factor 17 (CDC40) Recombinant Protein | CDC40 recombinant protein
Recombinant Human Pre-mRNA-processing factor 17 (CDC40)
Gene Names
CDC40; EHB3; PRP17; PRPF17
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pre-mRNA-processing factor 17 (CDC40); Recombinant Human Pre-mRNA-processing factor 17 (CDC40); CDC40 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-579, Full length protein
Sequence
MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD
Sequence Length
579
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CDC40 recombinant protein
Pre-mRNA splicing occurs in two sequential transesterification steps. This protein is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65,521 Da
NCBI Official Full Name
pre-mRNA-processing factor 17
NCBI Official Synonym Full Names
cell division cycle 40
NCBI Official Symbol
CDC40
NCBI Official Synonym Symbols
EHB3; PRP17; PRPF17
NCBI Protein Information
pre-mRNA-processing factor 17
UniProt Protein Name
Pre-mRNA-processing factor 17
UniProt Gene Name
CDC40
UniProt Synonym Gene Names
EHB3; PRP17; PRPF17; Ehb3; hPRP17
NCBI Description
Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression. [provided by RefSeq, Jul 2008]
Uniprot Description
Associates with the spliceosome late in the splicing pathway and may function in the second step of pre-mRNA splicing.
Research Articles on CDC40
Similar Products
Product Notes
The CDC40 cdc40 (Catalog #AAA1220145) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-579, Full length protein. The amino acid sequence is listed below: MSAAIAALAA SYGSGSGSES DSDSESSRCP LPAADSLMHL TKSPSSKPSL AVAVDSAPEV AVKEDLETGV HLDPAVKEVQ YNPTYETMFA PEFGPENPFR TQQMAAPRNM LSGYAEPAHI NDFMFEQQRR TFATYGYALD PSLDNHQVSA KYIGSVEEAE KNQGLTVFET GQKKTEKRKK FKENDASNID GFLGPWAKYV DEKDVAKPSE EEQKELDEIT AKRQKKGKQE EEKPGEEKTI LHVKEMYDYQ GRSYLHIPQD VGVNLRSTMP PEKCYLPKKQ IHVWSGHTKG VSAVRLFPLS GHLLLSCSMD CKIKLWEVYG ERRCLRTFIG HSKAVRDICF NTAGTQFLSA AYDRYLKLWD TETGQCISRF TNRKVPYCVK FNPDEDKQNL FVAGMSDKKI VQWDIRSGEI VQEYDRHLGA VNTIVFVDEN RRFVSTSDDK SLRVWEWDIP VDFKYIAEPS MHSMPAVTLS PNGKWLACQS MDNQILIFGA QNRFRLNKKK IFKGHMVAGY ACQVDFSPDM SYVISGDGNG KLNIWDWKTT KLYSRFKAHD KVCIGAVWHP HETSKVITCG WDGLIKLWD. It is sometimes possible for the material contained within the vial of "Pre-mRNA-processing factor 17 (CDC40), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
