Histidine transport system permease protein hisM (hisM) Recombinant Protein | hisM recombinant protein
Recombinant Escherichia coli Histidine transport system permease protein hisM (hisM)
Gene Names
hisM; ECK2301; JW2304
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histidine transport system permease protein hisM (hisM); Recombinant Escherichia coli Histidine transport system permease protein hisM (hisM); hisM recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-238
Sequence
MIEILHEYWKPLLWTDGYRFTGVAITLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIWLFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPFTAFGIAAVLYLIISYVLISLFRRAEKRWLQHVKPSSTH
Sequence Length
238
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for hisM recombinant protein
hisM
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,870 Da
NCBI Official Full Name
histidine/lysine/arginine/ornithine transporter subunit
NCBI Official Symbol
hisM
NCBI Official Synonym Symbols
ECK2301; JW2304
NCBI Protein Information
histidine/lysine/arginine/ornithine transporter subunit
UniProt Protein Name
Histidine transport system permease protein HisM
Protein Family
UniProt Gene Name
hisM
UniProt Entry Name
HISM_ECOLI
NCBI Description
HisPMQJ is an ATP-dependent histidine transport system that is a member of the ATP-Binding Cassette (ABC) Superfamily of transporters . [More information is available at EcoCyc: EG10007].
Uniprot Description
Function: Part of the binding-protein-dependent transport system for histidine; probably responsible for the translocation of the substrate across the membrane.
Subcellular location: Cell inner membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the binding-protein-dependent transport system permease family. HisMQ subfamily.Contains 1 ABC transmembrane type-1 domain.
Similar Products
Product Notes
The hisM hism (Catalog #AAA1206517) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-238. The amino acid sequence is listed below: MIEILHEYWK PLLWTDGYRF TGVAITLWLL ILSVVIGGVL ALFLAIGRVS SNKYIQFPIW LFTYIFRGTP LYVQLLVFYS GMYTLEIVKG TEFLNAFFRS GLNCTVLALT LNTCAYTTEI FAGAIRSVPH GEIEAARAYG FSTFKMYRCI ILPSALRIAL PAYSNEVILM LHSTALAFTA TVPDLLKIAR DINAATYQPF TAFGIAAVLY LIISYVLISL FRRAEKRWLQ HVKPSSTH. It is sometimes possible for the material contained within the vial of "Histidine transport system permease protein hisM (hisM), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
