Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit (ERI1) Recombinant Protein | ERI1 recombinant protein

Recombinant Saccharomyces cerevisiae Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit (ERI1)

Gene Names
ERI1; RIN1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit (ERI1); Recombinant Saccharomyces cerevisiae Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit (ERI1); Recombinant Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit (ERI1); Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit; Endoplasmic reticulum-associated Ras inhibitor protein 1; ERI1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-68
Sequence
MRPRDQGFLVLGFTYSVLLISLATFYWLRNNDSFLHYWCVLLLCPATLWLWALIAWCDSEMFASSKDE
Sequence Length
68
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,039 Da
NCBI Official Full Name
Eri1p
NCBI Official Symbol
ERI1
NCBI Official Synonym Symbols
RIN1
NCBI Protein Information
Eri1p
UniProt Protein Name
Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit
UniProt Gene Name
ERI1
UniProt Synonym Gene Names
RIN1
UniProt Entry Name
ERI1_YEAST

Uniprot Description

Function: Probable component of the GPI-GlcNAc transferase (GPI-GnT) complex in the endoplasmic reticulum, a complex that catalyzes transfer of GlcNAc from UDP-GlcNAc to an acceptor phosphatidylinositol, the first step in the production of GPI-anchors for cell surface proteins. Ras may inhibit the enzyme activity of the GPI-GnT complex via the association between ERI1 and RAS2. Ref.3 Ref.4

Pathway: Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.

Subunit structure: Interacts with GTP-bound RAS2 in an effector loop-dependent manner. Interacts with GPI2, suggesting that it is a component of the GPI-GnT complex, probably composed of GPI1, GPI2, GPI3, GPI15 and ERI1. Ref.3 Ref.4

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.3.

Disruption phenotype: Defects cause hyperactive Ras phenotypes, probably due to diminished GPI-anchor protein production. Ref.3

Similar Products

Product Notes

The ERI1 eri1 (Catalog #AAA1204754) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-68. The amino acid sequence is listed below: MRPRDQGFLV LGFTYSVLLI SLATFYWLRN NDSFLHYWCV LLLCPATLWL WALIAWCDSE MFASSKDE. It is sometimes possible for the material contained within the vial of "Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit (ERI1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.