<
Testing Data
(Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])
Mouse HDAC1 Monoclonal Antibody | anti-HDAC1 antibody
HDAC1 (Histone Deacetylase 1, DKFZp686H12203, GON-10, HD1, RPD3, RPD3L1) (AP)
Gene Names
HDAC1; HD1; RPD3; KDAC1; GON-10; RPD3L1
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
HDAC1; Monoclonal Antibody; HDAC1 (Histone Deacetylase 1; DKFZp686H12203; GON-10; HD1; RPD3; RPD3L1) (AP); Histone Deacetylase 1; RPD3L1; anti-HDAC1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
30
Specificity
Recognizes HDAC1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
482
Applicable Applications for anti-HDAC1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HDAC1 (AAH00301, 1aa-482aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])
Testing Data
(Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to HDAC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HDAC1 on HeLa cell. [antibody concentration 10 ug/ml])
Western Blot (WB)
(HDAC1 monoclonal antibody (M02), clone 3E1 Western Blot analysis of HDAC1 expression in Hela S3 NE.)
Western Blot (WB)
(HDAC1 monoclonal antibody (M02), clone 3E1 Western Blot analysis of HDAC1 expression in Hela S3 NE.)
Testing Data
(Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged HDAC1 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-HDAC1 antibody
Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq]
Product Categories/Family for anti-HDAC1 antibody
NCBI and Uniprot Product Information
NCBI Description
Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq, Jul 2008]
Research Articles on HDAC1
Similar Products
Product Notes
The HDAC1 (Catalog #AAA6162287) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HDAC1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HDAC1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HDAC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
