Uncharacterized oxidoreductase yjgI (yjgI) Recombinant Protein | yjgI recombinant protein
Recombinant Escherichia coli Uncharacterized oxidoreductase yjgI (yjgI)
Gene Names
bdcA; ECK4243; JW4207; yjgI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized oxidoreductase yjgI (yjgI); Recombinant Escherichia coli Uncharacterized oxidoreductase yjgI (yjgI); yjgI recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-237, full length protein
Sequence
MGAFTGKTVLILGGSRGIGAAIVRRFVTDGANVRFTYAGSKDAAKRLAQETGATAVFTDSADRDAVIDVVRKSGALDILVVNAGIGVFGEALELNADDIDRLFKINIHAPYHASVEAARQMPEGGRILIIGSVNGDRMPVAGMAAYAASKSALQGMARGLARDFGPRGITINVVQPGPIDTDANPANGPMRDMLHSLMAIKRHGQPEEVAGMVAWLAGPEASFVTGAMHTIDGAFGA
Sequence Length
237
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,598 Da
NCBI Official Full Name
c-di-GMP-binding biofilm dispersal mediator protein
NCBI Official Symbol
bdcA
NCBI Official Synonym Symbols
ECK4243; JW4207; yjgI
NCBI Protein Information
c-di-GMP-binding biofilm dispersal mediator protein
UniProt Protein Name
Cyclic-di-GMP-binding biofilm dispersal mediator protein
UniProt Gene Name
bdcA
UniProt Synonym Gene Names
yjgI
NCBI Description
The divergent YjgJ could be be a YjgI regulator. [More information is available at EcoGene: EG12528]. YjgI did not show dehydrogenase activity in a high-throughput screen of purified proteins . [More information is available at EcoCyc: G7880].
Uniprot Description
Increases biofilm dispersal. Acts by binding directly to the signaling molecule cyclic-di-GMP, which decreases the intracellular concentration of cyclic-di-GMP and leads to biofilm dispersal. Also controls other biofilm-related phenotypes such as cell motility, cell size, cell aggregation and production of extracellular DNA and extracellular polysaccharides (EPS). Does not act as a phosphodiesterase.
Similar Products
Product Notes
The yjgI bdca (Catalog #AAA1160125) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-237, full length protein. The amino acid sequence is listed below: MGAFTGKTVL ILGGSRGIGA AIVRRFVTDG ANVRFTYAGS KDAAKRLAQE TGATAVFTDS ADRDAVIDVV RKSGALDILV VNAGIGVFGE ALELNADDID RLFKINIHAP YHASVEAARQ MPEGGRILII GSVNGDRMPV AGMAAYAASK SALQGMARGL ARDFGPRGIT INVVQPGPID TDANPANGPM RDMLHSLMAI KRHGQPEEVA GMVAWLAGPE ASFVTGAMHT IDGAFGA. It is sometimes possible for the material contained within the vial of "Uncharacterized oxidoreductase yjgI (yjgI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
