Extracellular matrix protein 2 (ECM2) Recombinant Protein | ECM2 recombinant protein
Recombinant Human Extracellular matrix protein 2 (ECM2), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Extracellular matrix protein 2 (ECM2); Recombinant Human Extracellular matrix protein 2 (ECM2); partial; ECM2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-699aa, Extracellular domain
Sequence
KNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLPIVNFDYSMEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEPCTTCLCSDGRVLCDETMCHPQRCPQTVIPEGECCPVCSATVSYSLLSGIALNDRNEFSGDSSEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEEDTEQKRETPESRNQGQLYSEGDSRGGDRKQRPGEERRLAHQQQRQGREEEEDEEEEGEEGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPDEAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELKVNENNLQAIDEESLSDLNQLVTLELEGNNLSEANVNPLAFKPLKSLAYLRLGKNKFRIIPQGLPGSIEELYLENNQIEEITEICFNHTRKINVIVLRYNKIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGMDRVSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALHFLRLNNNKIRNILPEEICNAEEDDDSNLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLKPQNIK
Sequence Length
643
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ECM2 recombinant protein
ECM2 encodes extracellular matrix protein 2, so named because it shares extensive similarity with known extracelluar matrix protiens.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
73,348 Da
NCBI Official Full Name
extracellular matrix protein 2 isoform 2
NCBI Official Synonym Full Names
extracellular matrix protein 2
NCBI Official Symbol
ECM2
NCBI Protein Information
extracellular matrix protein 2
UniProt Protein Name
Extracellular matrix protein 2
Protein Family
UniProt Gene Name
ECM2
NCBI Description
ECM2 encodes extracellular matrix protein 2, so named because it shares extensive similarity with known extracelluar matrix proteins. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
Uniprot Description
Promotes matrix assembly and cell adhesiveness.
Similar Products
Product Notes
The ECM2 ecm2 (Catalog #AAA1127808) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-699aa, Extracellular domain. The amino acid sequence is listed below: KNEEIPRKQR RKIYHRRLRK SSTSHKHRSN RQLGIQQTTV FTPVARLPIV NFDYSMEEKF ESFSSFPGVE SSYNVLPGKK GHCLVKGITM YNKAVWSPEP CTTCLCSDGR VLCDETMCHP QRCPQTVIPE GECCPVCSAT VSYSLLSGIA LNDRNEFSGD SSEQREPTNL LHKQLPPPQV GMDRIVRKEA LQSEEDEEVK EEDTEQKRET PESRNQGQLY SEGDSRGGDR KQRPGEERRL AHQQQRQGRE EEEDEEEEGE EGEEDEEDEE DPVRGDMFRM PSRSPLPAPP RGTLRLPSGC SLSYRTISCI NAMLTQIPPL TAPQITSLEL TGNSIASIPD EAFNGLPNLE RLDLSKNNIT SSGIGPKAFK LLKKLMRLNM DGNNLIQIPS QLPSTLEELK VNENNLQAID EESLSDLNQL VTLELEGNNL SEANVNPLAF KPLKSLAYLR LGKNKFRIIP QGLPGSIEEL YLENNQIEEI TEICFNHTRK INVIVLRYNK IEENRIAPLA WINQENLESI DLSYNKLYHV PSYLPKSLLH LVLLGNQIER IPGYVFGHME PGLEYLYLSF NKLADDGMDR VSFYGAYHSL RELFLDHNDL KSIPPGIQEM KALHFLRLNN NKIRNILPEE ICNAEEDDDS NLEHLHLENN YIKIREIPSY TFSCIRSYSS IVLKPQNIK. It is sometimes possible for the material contained within the vial of "Extracellular matrix protein 2 (ECM2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
