Western Blot (WB)
(WB Suggested Anti-ECM2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Rabbit anti-Human ECM2 Polyclonal Antibody | anti-ECM2 antibody
ECM2 Antibody - N-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ECM2; Polyclonal Antibody; ECM2 Antibody - N-terminal region; anti-ECM2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLP
Sequence Length
643
Applicable Applications for anti-ECM2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ECM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ECM2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Western Blot (WB)
(WB Suggested Anti-ECM2 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Related Product Information for anti-ECM2 antibody
This is a rabbit polyclonal antibody against ECM2. It was validated on Western Blot
Target Description: ECM2 encodes extracellular matrix protein 2, so named because it shares extensive similarity with known extracelluar matrix proteins. Three transcript variants encoding different isoforms have been found for this gene.
Target Description: ECM2 encodes extracellular matrix protein 2, so named because it shares extensive similarity with known extracelluar matrix proteins. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ECM2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
extracellular matrix protein 2 isoform 3
NCBI Official Synonym Full Names
extracellular matrix protein 2
NCBI Official Symbol
ECM2
NCBI Protein Information
extracellular matrix protein 2
UniProt Protein Name
Extracellular matrix protein 2
Protein Family
UniProt Gene Name
ECM2
UniProt Entry Name
ECM2_HUMAN
NCBI Description
ECM2 encodes extracellular matrix protein 2, so named because it shares extensive similarity with known extracelluar matrix proteins. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
Uniprot Description
ECM2: Promotes matrix assembly and cell adhesiveness. Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted; Secreted, signal peptide; Cell adhesion
Chromosomal Location of Human Ortholog: 9q22.3
Cellular Component: proteinaceous extracellular matrix
Molecular Function: heparin binding; integrin binding
Biological Process: extracellular matrix organization and biogenesis; cell-matrix adhesion
Similar Products
Product Notes
The ECM2 ecm2 (Catalog #AAA3216821) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ECM2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ECM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ECM2 ecm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGKNEEIPRK QRRKIYHRRL RKSSTSHKHR SNRQLGIQQT TVFTPVARLP. It is sometimes possible for the material contained within the vial of "ECM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
