Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DNA (cytosine-5)-methyltransferase 3B (Dnmt3b) Recombinant Protein | Dnmt3b recombinant protein

Recombinant Mouse DNA (cytosine-5)-methyltransferase 3B (Dnmt3b) , partial

Gene Names
Dnmt3b; MmuIIIB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA (cytosine-5)-methyltransferase 3B (Dnmt3b); Recombinant Mouse DNA (cytosine-5)-methyltransferase 3B (Dnmt3b); partial; Dnmt3b recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
428-560, partial, provide the ADD domain
Sequence
EVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPD
Sequence Length
560
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Dnmt3b recombinant protein
CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Six alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90,021 Da
NCBI Official Full Name
DNA (cytosine-5)-methyltransferase 3B isoform 2
NCBI Official Synonym Full Names
DNA methyltransferase 3B
NCBI Official Symbol
Dnmt3b
NCBI Official Synonym Symbols
MmuIIIB
NCBI Protein Information
DNA (cytosine-5)-methyltransferase 3B
UniProt Protein Name
DNA (cytosine-5)-methyltransferase 3B
Protein Family
DNA
UniProt Gene Name
Dnmt3b
UniProt Synonym Gene Names
Dnmt3b; DNA MTase MmuIIIB; M.MmuIIIB

NCBI Description

This is one of two related genes encoding de novo DNA methyltransferases, which are responsible for the establishment of DNA methylation patterns in embryos. Loss of function of this gene results in severe developmental defects and loss of viability. Mutation of the related gene in humans causes immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. There is a pseudogene for this gene located adjacent to this gene in the same region of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Nov 2012]

Uniprot Description

Required for genome-wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. May preferentially methylates nucleosomal DNA within the nucleosome core region. May function as transcriptional co-repressor by associating with CBX4 and independently of DNA methylation. Seems to be involved in gene silencing. In association with DNMT1 and via the recruitment of CTCFL/BORIS, involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. Function as transcriptional corepressor by associating with ZHX1 (). Required for DUX4 silencing in somatic cells ().

Research Articles on Dnmt3b

Similar Products

Product Notes

The Dnmt3b dnmt3b (Catalog #AAA1101053) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 428-560, partial, provide the ADD domain. The amino acid sequence is listed below: EVTNNKGNLE DRCLSCGKKN PVSFHPLFEG GLCQSCRDRF LELFYMYDED GYQSYCTVCC EGRELLLCSN TSCCRCFCVE CLEVLVGAGT AEDAKLQEPW SCYMCLPQRC HGVLRRRKDW NMRLQDFFTT DPD . It is sometimes possible for the material contained within the vial of "DNA (cytosine-5)-methyltransferase 3B (Dnmt3b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.