Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Selenoprotein P (SEPP1) Recombinant Protein | SEPP1 recombinant protein

Recombinant Human Selenoprotein P (SEPP1) (U59S, U300S, U318S, U330S, U345S, U352S, U367S, U369S, U376S, U378S)

Gene Names
SEPP1; SeP; SELP; SEPP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Selenoprotein P (SEPP1); Recombinant Human Selenoprotein P (SEPP1) (U59S; U300S; U318S; U330S; U345S; U352S; U367S; U369S; U376S; U378S); SEPP1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-381aa (U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S) ;Full Length of Mature Protein
Sequence
ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Sequence

(There are 10 selenocysteine (U) in the original sequence. The amino acids at multiple sites are ‘U’ in UniProt (yellow highlighted; U59S, U300S, U318S, U330S, U345S, U352S, U367S, U369S, U376S, U378S), reference:: https://www.uniprot.org/uniprot/P49908 ). The ‘U’ at each yellow highlighted site has been mutated to ‘S’ to manufacture the MBS1065524 Recombinant Human Selenoprotein P. 'U' selenocysteine is encoded by UGA and it is normally used as a stop codon in prokaryotic cells, which will lead to early termination of translation, hence the lab mutates this selenocysteine for protein manufacturing. In terms of the formation of selenocysteine, selenocysteine is actually a derivative of serine. Selenocysteine and cysteine as well as serine are all highly similar. This selenocysteine can be regarded as either the 'S' of cysteine replaced by Se, or the 'O' of serine replaced by Se. The selenocysteine can mutated to be either serine or cysteine.Generally, the lab mutates 'U' to serine for protein expression because mutating the 'U' to cysteine may result in the formation of additional disulfide bonds, potentially affecting the expression and structure of the protein.)

SDS-Page

Related Product Information for SEPP1 recombinant protein
Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.
References
Conserved nucleotide sequences in the open reading frame and 3' untranslated region of selenoprotein P mRNA.Hill K.E., Lloyd R.S., Burk R.F.Proc. Natl. Acad. Sci. U.S.A. 90:537-541(1993) Hill K.E.NIEHS SNPs programThe DNA sequence and comparative analysis of human chromosome 5.Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S., Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.Nature 431:268-274(2004) Purification of selenoprotein P from human plasma.Aakesson B., Bellew T., Burk R.F.Biochim. Biophys. Acta 1204:243-249(1994) A novel method for the purification of selenoprotein P from human plasma.Mostert V., Lombeck I., Abel J.Arch. Biochem. Biophys. 357:326-330(1998) Selenoprotein P properties, functions, and regulation.Mostert V.Arch. Biochem. Biophys. 376:433-438(2000) Selenoprotein P. A selenium-rich extracellular glycoprotein.Burk R.F., Hill K.E.J. Nutr. 124:1891-1897(1994) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) A strategy for precise and large scale identification of core fucosylated glycoproteins.Jia W., Lu Z., Fu Y., Wang H.P., Wang L.H., Chi H., Yuan Z.F., Zheng Z.B., Song L.N., Han H.H., Liang Y.M., Wang J.L., Cai Y., Zhang Y.K., Deng Y.L., Ying W.T., He S.M., Qian X.H.Mol. Cell. Proteomics 8:913-923(2009) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42.6 kDa
NCBI Official Full Name
selenoprotein P isoform 1
NCBI Official Synonym Full Names
selenoprotein P, plasma, 1
NCBI Official Symbol
SEPP1
NCBI Official Synonym Symbols
SeP; SELP; SEPP
NCBI Protein Information
selenoprotein P
UniProt Protein Name
Selenoprotein P
Protein Family
UniProt Gene Name
SEPP1
UniProt Synonym Gene Names
SELP; SeP
UniProt Entry Name
SEPP1_HUMAN

NCBI Description

This gene encodes a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space. Several transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SEPP1: Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis. Belongs to the selenoprotein P family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: extracellular region; extracellular space

Molecular Function: selenium binding

Biological Process: brain development; growth; locomotory behavior; post-embryonic development; response to oxidative stress; selenium metabolic process; sexual reproduction

Research Articles on SEPP1

Similar Products

Product Notes

The SEPP1 sepp1 (Catalog #AAA1065524) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-381aa (U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S) ;Full Length of Mature Protein. The amino acid sequence is listed below: ESQDQSSLCK QPPAWSIRDQ DPMLNSNGSV TVVALLQASS YLCILQASKL EDLRVKLKKE GYSNISYIVV NHQGISSRLK YTHLKNKVSE HIPVYQQEEN QTDVWTLLNG SKDDFLIYDR CGRLVYHLGL PFSFLTFPYV EEAIKIAYCE KKCGNCSLTT LKDEDFCKRV SLATVDKTVE TPSPHYHHEH HHNHGHQHLG SSELSENQQP GAPNAPTHPA PPGLHHHHKH KGQHRQGHPE NRDMPASEDL QDLQKKLCRK RCINQLLCKL PTDSELAPRS SCCHCRHLIF EKTGSAITSQ CKENLPSLCS SQGLRAEENI TESCQSRLPP AASQISQQLI PTEASASSRS KNQAKKSESP SN. It is sometimes possible for the material contained within the vial of "Selenoprotein P (SEPP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual