Zinc finger and BTB domain-containing protein 49 (Zbtb49) Recombinant Protein | Zbtb49 recombinant protein
Recombinant Mouse Zinc finger and BTB domain-containing protein 49 (Zbtb49)
Gene Names
Zbtb49; Zfp509; Znf509; 4930518A03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger and BTB domain-containing protein 49 (Zbtb49); Recombinant Mouse Zinc finger and BTB domain-containing protein 49 (Zbtb49); Zbtb49 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-756, Full length protein
Sequence
MDPVAVHSCHLLQQLREQRIQGLLCDCMLVVRGVCFKAHKNVLAAFSQYFRSLFQNSSSQKNDVFHLDVTNVSGIGQILDFMYTSRLDLNQDNIQVMLDTAQCLQVQNVLNLCHTFLKSAPAAQLPGLPCAGGFSLQSVALDGTCAVSEHYPPPSLQECPVEGPQAKVPAEVNARAPSANFSRPTEVSKPDAAGGSCPELPCKQPNHYYKLRTLYSKQYYKQTACPSQVPATQQPLTRSASTDLAAADSQPPVEGRPAVLETPEHLPSTFVAPPVRNSGNDSEADPLSEPPAKQMRLKKAMHLKKLNFLKSQQSAECTSHPEPDNGLARREESAAKEDAVERAGSQTAEEKGRGELGPESSREEELPGAPASWEDPSQALQPQKQYACELCGKPFKHPSNLELHKRSHTGEKPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQRHIIIHSGEKPHLCDTCGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHRVRHTGERPYSCPACGKCFGGSGDLRRHVRTHTGEKPYSCEVCSKCFTRSAVLRRHKRMHGRADARSPVVLGELSRPIEPSDLDRSQSSDSFSQDVSVTLMPVSVKLPVQPVESSVAGFDGHCSGSYCKLRSMLRPPGMSDQDRLSLEPSKLAKPPELQSQPQAYAYSDVEPSAGVEQPQADGMAVSRSSLATLDNHCTEPLGSRAPSVTYRNSEGQFFSSMTLWGLAMKTLQNEHELEQ
Sequence Length
756
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,350 Da
NCBI Official Full Name
zinc finger and BTB domain-containing protein 49 isoform 1
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 49
NCBI Official Symbol
Zbtb49
NCBI Official Synonym Symbols
Zfp509; Znf509; 4930518A03Rik
NCBI Protein Information
zinc finger and BTB domain-containing protein 49
UniProt Protein Name
Zinc finger and BTB domain-containing protein 49
Protein Family
UniProt Gene Name
Zbtb49
UniProt Synonym Gene Names
Zfp509; Znf509
Uniprot Description
Transcription factor. Inhibits cell proliferation by activating either CDKN1A/p21 transcription or RB1 transcription.
Similar Products
Product Notes
The Zbtb49 zbtb49 (Catalog #AAA1289019) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-756, Full length protein. The amino acid sequence is listed below: MDPVAVHSCH LLQQLREQRI QGLLCDCMLV VRGVCFKAHK NVLAAFSQYF RSLFQNSSSQ KNDVFHLDVT NVSGIGQILD FMYTSRLDLN QDNIQVMLDT AQCLQVQNVL NLCHTFLKSA PAAQLPGLPC AGGFSLQSVA LDGTCAVSEH YPPPSLQECP VEGPQAKVPA EVNARAPSAN FSRPTEVSKP DAAGGSCPEL PCKQPNHYYK LRTLYSKQYY KQTACPSQVP ATQQPLTRSA STDLAAADSQ PPVEGRPAVL ETPEHLPSTF VAPPVRNSGN DSEADPLSEP PAKQMRLKKA MHLKKLNFLK SQQSAECTSH PEPDNGLARR EESAAKEDAV ERAGSQTAEE KGRGELGPES SREEELPGAP ASWEDPSQAL QPQKQYACEL CGKPFKHPSN LELHKRSHTG EKPFECNICG KHFSQAGNLQ THLRRHSGEK PYICEICGKR FAASGDVQRH IIIHSGEKPH LCDTCGRGFS NFSNLKEHKK THTADKVFTC DECGKSFNMQ RKLVKHRVRH TGERPYSCPA CGKCFGGSGD LRRHVRTHTG EKPYSCEVCS KCFTRSAVLR RHKRMHGRAD ARSPVVLGEL SRPIEPSDLD RSQSSDSFSQ DVSVTLMPVS VKLPVQPVES SVAGFDGHCS GSYCKLRSML RPPGMSDQDR LSLEPSKLAK PPELQSQPQA YAYSDVEPSA GVEQPQADGM AVSRSSLATL DNHCTEPLGS RAPSVTYRNS EGQFFSSMTL WGLAMKTLQN EHELEQ. It is sometimes possible for the material contained within the vial of "Zinc finger and BTB domain-containing protein 49 (Zbtb49), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
