14-3-3 protein beta/alpha (Ywhab) Recombinant Protein | Ywhab recombinant protein

Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab)

Cat. Num. AAA1406973

• Gene Names: Ywhab; 1300003C17Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 14-3-3 protein beta/alpha (Ywhab); Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab); 14-3-3 protein beta/alpha; Protein kinase C inhibitor protein 1; KCIP-1Cleaved into the following chain:; 1. 14-3-3 protein beta/alpha; N-terminally processed; Ywhab recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-246aa; Full Length
• Sequence: MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
• Sequence Length: 246

• Species: Mus musculus (Mouse)
• Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for Ywhab recombinant protein

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13.

Product Categories/Family for Ywhab recombinant protein

Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 31543974
• NCBI GeneID: 54401
• NCBI Accession #: NP_061223.2
• NCBI GenBank Nucleotide #: NM_018753.6
• UniProt Accession #: Q9CQV8; O70455; Q3TY33; Q3UAN6
• Molecular Weight: 30.1 kDa
• NCBI Official Full Name: 14-3-3 protein beta/alpha
• NCBI Official Synonym Full Names: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide
• NCBI Official Symbol: Ywhab
• NCBI Official Synonym Symbols: 1300003C17Rik
• NCBI Protein Information: 14-3-3 protein beta/alpha; KCIP-1; protein kinase C inhibitor protein 1; tyrosine 3/tryptophan 5 -monooxygenase activation protein, beta polypeptide
• UniProt Protein Name: 14-3-3 protein beta/alpha
• Protein Family: 14-3-3 protein
• UniProt Gene Name: Ywhab
• UniProt Synonym Gene Names: KCIP-1
• UniProt Entry Name: 1433B_MOUSE

Uniprot Description

14-3-3 beta: a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. A multifunctional regulator of the cell signaling processes.

Protein type: Adaptor/scaffold

Cellular Component: focal adhesion; protein complex; membrane; transcriptional repressor complex; cell; perinuclear region of cytoplasm; cytoplasm; intracellular; nucleus

Molecular Function: protein C-terminus binding; protein domain specific binding; protein binding; enzyme binding; histone deacetylase binding; protein complex binding; phosphoprotein binding; transcription corepressor activity; phosphoserine binding

Biological Process: positive regulation of catalytic activity; negative regulation of protein amino acid dephosphorylation; protein heterooligomerization; cytoplasmic sequestering of protein; negative regulation of transcription, DNA-dependent; protein targeting