Receptor-type tyrosine-protein phosphatase zeta Recombinant Protein | PTPRZ1 recombinant protein

Recombinant Human Receptor-type tyrosine-protein phosphatase zeta

Cat. Num. AAA948562

• Gene Names: PTPRZ1; PTPZ; HPTPZ; PTP18; PTPRZ; RPTPB; HPTPzeta; PTP-ZETA; RPTPbeta; phosphacan; R-PTP-zeta-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Receptor-type tyrosine-protein phosphatase zeta; Recombinant Human Receptor-type tyrosine-protein phosphatase zeta; Protein-tyrosine phosphatase receptor type Z polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 2; R-PTP-zeta-2; PTPRZ1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 36-300aa; Partial
• Sequence: IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

• Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PTPRZ1 recombinant protein

Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual mory, probably via the dephosphorylation of proteins that are part of important signaling cascades.

Product Categories/Family for PTPRZ1 recombinant protein

Neuroscience

References

A human transmembrane protein-tyrosine-phosphatase, PTP zeta, is expressed in brain and has an N-terminal receptor domain homologous to carbonic anhydrases.Krueger N.X., Saito H.Proc. Natl. Acad. Sci. U.S.A. 89:7417-7421(1992) The cloning of a receptor-type protein tyrosine phosphatase expressed in the central nervous system.Levy J.B., Canoll P.D., Silvennoinen O., Barnea G., Morse B., Honegger A.M., Huang J.-T., Cannizzaro L.A., Park S.-H., Druck T., Huebner K., Sap J., Ehrlich M., Musacchio J.M., Schlessinger J.J. Biol. Chem. 268:10573-10581(1993) The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003) Human chromosome 7 DNA sequence and biology.Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S., Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.Science 300:767-772(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 332205943
• NCBI GeneID: 5803
• NCBI Accession #: NP_001193767.1
• NCBI GenBank Nucleotide #: NM_001206838.1
• UniProt Accession #: P23471; O76043; Q9UDR6; A4D0W5; C9JFM0
• Molecular Weight: 32.1 kDa
• NCBI Official Full Name: receptor-type tyrosine-protein phosphatase zeta isoform 2
• NCBI Official Synonym Full Names: protein tyrosine phosphatase, receptor type Z1
• NCBI Official Symbol: PTPRZ1
• NCBI Official Synonym Symbols: PTPZ; HPTPZ; PTP18; PTPRZ; RPTPB; HPTPzeta; PTP-ZETA; RPTPbeta; phosphacan; R-PTP-zeta-2
• NCBI Protein Information: receptor-type tyrosine-protein phosphatase zeta
• UniProt Protein Name: Receptor-type tyrosine-protein phosphatase zeta
• Protein Family: Receptor-type tyrosine-protein phosphatase
• UniProt Gene Name: PTPRZ1
• UniProt Synonym Gene Names: HTPZP2; PTPRZ; PTPRZ2; PTPZ; R-PTP-zeta
• UniProt Entry Name: PTPRZ_HUMAN

NCBI Description

This gene encodes a member of the receptor protein tyrosine phosphatase family. Expression of this gene is restricted to the central nervous system (CNS), and it may be involved in the regulation of specific developmental processes in the CNS. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, May 2011]

Uniprot Description

PTPRZ1: May be involved in the regulation of specific developmental processes in the CNS. Belongs to the protein-tyrosine phosphatase family. Receptor class 5 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; EC 3.1.3.48; Receptor protein phosphatase, tyrosine

Chromosomal Location of Human Ortholog: 7q31.3

Cellular Component: axon; cell soma; cytoplasm; dendritic spine; extracellular space; filopodium; growth cone; integral to plasma membrane; lamellipodium; postsynaptic membrane; proteinaceous extracellular matrix

Molecular Function: fibroblast growth factor binding; protein binding; protein tyrosine phosphatase activity; transmembrane receptor protein tyrosine phosphatase activity

Biological Process: axonal fasciculation; axonogenesis; central nervous system development; hemopoietic progenitor cell differentiation; hippocampus development; learning and/or memory; negative regulation of cell proliferation; oligodendrocyte differentiation; positive regulation of fibroblast proliferation; positive regulation of peptidyl-tyrosine phosphorylation; protein amino acid dephosphorylation; regulation of dendrite morphogenesis; visual learning

Disease: Helicobacter Pylori Infection, Susceptibility To