YTH domain family protein 1 (YTHDF1) Recombinant Protein | YTHDF1 recombinant protein
Recombinant Human YTH domain family protein 1 (YTHDF1)
Gene Names
YTHDF1; C20orf21
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
YTH domain family protein 1 (YTHDF1); Recombinant Human YTH domain family protein 1 (YTHDF1); YTHDF1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-559, Full length protein
Sequence
SATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ
Sequence Length
558
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,833 Da
NCBI Official Full Name
YTH domain-containing family protein 1
NCBI Official Synonym Full Names
YTH N6-methyladenosine RNA binding protein 1
NCBI Official Symbol
YTHDF1
NCBI Official Synonym Symbols
C20orf21
NCBI Protein Information
YTH domain-containing family protein 1
UniProt Protein Name
YTH domain-containing family protein 1
Protein Family
UniProt Gene Name
YTHDF1
UniProt Synonym Gene Names
DACA-1
Uniprot Description
Specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency (PubMed:24284625, PubMed:26046440, PubMed:26318451). M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability (PubMed:24284625). Acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation (PubMed:26046440).
Research Articles on YTHDF1
Similar Products
Product Notes
The YTHDF1 ythdf1 (Catalog #AAA1288158) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-559, Full length protein. The amino acid sequence is listed below: SATSVDTQRT KGQDNKVQNG SLHQKDTVHD NDFEPYLTGQ SNQSNSYPSM SDPYLSSYYP PSIGFPYSLN EAPWSTAGDP PIPYLTTYGQ LSNGDHHFMH DAVFGQPGGL GNNIYQHRFN FFPENPAFSA WGTSGSQGQQ TQSSAYGSSY TYPPSSLGGT VVDGQPGFHS DTLSKAPGMN SLEQGMVGLK IGDVSSSAVK TVGSVVSSVA LTGVLSGNGG TNVNMPVSKP TSWAAIASKP AKPQPKMKTK SGPVMGGGLP PPPIKHNMDI GTWDNKGPVP KAPVPQQAPS PQAAPQPQQV AQPLPAQPPA LAQPQYQSPQ QPPQTRWVAP RNRNAAFGQS GGAGSDSNSP GNVQPNSAPS VESHPVLEKL KAAHSYNPKE FEWNLKSGRV FIIKSYSEDD IHRSIKYSIW CSTEHGNKRL DSAFRCMSSK GPVYLLFSVN GSGHFCGVAE MKSPVDYGTS AGVWSQDKWK GKFDVQWIFV KDVPNNQLRH IRLENNDNKP VTNSRDTQEV PLEKAKQVLK IISSYKHTTS IFDDFAHYEK RQEEEEVVRK ERQSRNKQ. It is sometimes possible for the material contained within the vial of "YTH domain family protein 1 (YTHDF1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
