SDS-PAGE
Yippee-like 1 Recombinant Protein | YPEL1 recombinant protein
Recombinant Human Protein yippee-like 1
Gene Names
YPEL1; FKSG3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Yippee-like 1; Recombinant Human Protein yippee-like 1; YPEL1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-119aa; Full Length
Sequence
MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE
Sequence Length
119
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Product Categories/Family for YPEL1 recombinant protein
References
Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.Hosono K., Sasaki T., Minoshima S., Shimizu N.Gene 340:31-43(2004)
Human unknown cDNA, complete cds.Hu G., Hui L.Cloning and characterization of FKSG3, a novel gene related to DiGeorge syndrome.Wang Y.-G.A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004)
The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29.6 kDa
NCBI Official Full Name
protein yippee-like 1
NCBI Official Synonym Full Names
yippee like 1
NCBI Official Symbol
YPEL1
NCBI Official Synonym Symbols
FKSG3
NCBI Protein Information
protein yippee-like 1
UniProt Protein Name
Protein yippee-like 1
Protein Family
UniProt Gene Name
YPEL1
UniProt Entry Name
YPEL1_HUMAN
NCBI Description
This gene is located in the region associated with DiGeorge syndrome on chromosome 22. The encoded protein localizes to the centrosome and nucleolus and may play a role in the regulation of cell division. [provided by RefSeq, Feb 2015]
Uniprot Description
YPEL1: May play a role in epithelioid conversion of fibroblasts. Belongs to the yippee family
Chromosomal Location of Human Ortholog: 22q11.2
Cellular Component: nucleus
Research Articles on YPEL1
Similar Products
Product Notes
The YPEL1 ypel1 (Catalog #AAA1240908) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-119aa; Full Length. The amino acid sequence is listed below: MVKMTKSKTF QAYLPNCHRT YSCIHCRAHL ANHDELISKS FQGSQGRAYL FNSVVNVGCG PAEERVLLTG LHAVADIYCE NCKTTLGWKY EHAFESSQKY KEGKFIIELA HMIKDNGWE. It is sometimes possible for the material contained within the vial of "Yippee-like 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
