Probable anaerobic dimethyl sulfoxide reductase chain ynfG (ynfG) Recombinant Protein | ynfG recombinant protein
Recombinant Escherichia coli Probable anaerobic dimethyl sulfoxide reductase chain ynfG (ynfG)
Gene Names
ynfG; ECK1584; JW1581
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable anaerobic dimethyl sulfoxide reductase chain ynfG (ynfG); Recombinant Escherichia coli Probable anaerobic dimethyl sulfoxide reductase chain ynfG (ynfG); ynfG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-205, full length protein
Sequence
TTQYGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLSISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMTKCDGCYSRVAEGKQPICVESCPLRALEFGPIEELRQKHGTLAAVAPLPRAHFTKPNIVIKPNANSRPTGDTTGYLANPEEV
Sequence Length
204
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,752 Da
NCBI Official Full Name
oxidoreductase, Fe-S subunit
NCBI Official Symbol
ynfG
NCBI Official Synonym Symbols
ECK1584; JW1581
NCBI Protein Information
oxidoreductase, Fe-S subunit
UniProt Protein Name
Probable anaerobic dimethyl sulfoxide reductase chain YnfG
Protein Family
UniProt Gene Name
ynfG
NCBI Description
The physiological substrate and relevance of the YnfFGH S- and N-oxide reductase is unknown. [More information is available at EcoGene: EG13845]. YnfG is highly similar to DmsB, the iron-sulfur cluster-containing subunit of the dimethyl sulfoxide reductase heterotrimer, and cross-reacts with an anti-DmsB antibody. [More information is available at EcoCyc: G6847].
Uniprot Description
Electron transfer subunit of the terminal reductase during anaerobic growth on various sulfoxide and N-oxide compounds.
Similar Products
Product Notes
The ynfG ynfg (Catalog #AAA1048564) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-205, full length protein. The amino acid sequence is listed below: TTQYGFFIDS SRCTGCKTCE LACKDFKDLG PEVSFRRIYE YAGGDWQEDN GVWHQNVFAY YLSISCNHCD DPACTKVCPS GAMHKREDGF VVVDEDVCIG CRYCHMACPY GAPQYNAEKG HMTKCDGCYS RVAEGKQPIC VESCPLRALE FGPIEELRQK HGTLAAVAPL PRAHFTKPNI VIKPNANSRP TGDTTGYLAN PEEV. It is sometimes possible for the material contained within the vial of "Probable anaerobic dimethyl sulfoxide reductase chain ynfG (ynfG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
