Putative ATP synthase protein YMF19 (YMF19) Recombinant Protein | YMF19 recombinant protein
Recombinant Helianthus annuus Putative ATP synthase protein YMF19 (YMF19)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative ATP synthase protein YMF19 (YMF19); Recombinant Helianthus annuus Putative ATP synthase protein YMF19 (YMF19); Recombinant Putative ATP synthase protein YMF19 (YMF19); Putative ATP synthase protein YMF19 EC= 3.6.3.14; Mitochondrial protein YMF19; YMF19 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-159
Sequence
MPQLDKFTYFTQFFWSCLFLFTFYIAICNDGDGLLGISRILKLRNQLLSHRTNNIRSKDPNSLEDILRKGFSTGLSYMYSSLFEDSQWCKAVDLLGKRRKITLISCFGEISGSRGMERNIFYLISKSSYSTSSNPGWGITCRNDIMLIHVPHGQGSIGF
Sequence Length
159
Species
Helianthus annuus (Common sunflower)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
18,164 Da
NCBI Official Full Name
Putative ATP synthase protein YMF19
UniProt Protein Name
Putative ATP synthase protein YMF19
Protein Family
UniProt Gene Name
YMF19
UniProt Entry Name
YMF19_HELAN
Uniprot Description
Function: This is one of the chains of the nonenzymatic component (CF0 subunit) of the mitochondrial ATPase complex
By similarity.
Catalytic activity: ATP + H2O + H+(In) = ADP + phosphate + H+(Out).
Subunit structure: F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. CF0 has three main subunits: a, b and c
By similarity.
Subcellular location: Mitochondrion membrane; Single-pass membrane protein
By similarity.
Sequence similarities: Belongs to the ATPase protein YMF19 family.
Similar Products
Product Notes
The Putative ATP synthase protein YMF19 (YMF19) ymf19 (Catalog #AAA1027683) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-159. The amino acid sequence is listed below: MPQLDKFTYF TQFFWSCLFL FTFYIAICND GDGLLGISRI LKLRNQLLSH RTNNIRSKDP NSLEDILRKG FSTGLSYMYS SLFEDSQWCK AVDLLGKRRK ITLISCFGEI SGSRGMERNI FYLISKSSYS TSSNPGWGIT CRNDIMLIHV PHGQGSIGF. It is sometimes possible for the material contained within the vial of "Putative ATP synthase protein YMF19 (YMF19), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
